KEGG   Monosiga brevicollis: MONBRDRAFT_22706Help
Entry
MONBRDRAFT_22706  CDS       T01042                                 

Definition
(RefSeq) hypothetical protein
  KO
K01374  cathepsin O [EC:3.4.22.42]
Organism
mbr  Monosiga brevicollis
Brite
KEGG Orthology (KO) [BR:mbr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mbr01002]
    MONBRDRAFT_22706
Enzymes [BR:mbr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.42  cathepsin O
     MONBRDRAFT_22706
Peptidases [BR:mbr01002]
 Cysteine Peptidases
  Family C1: papain family
   MONBRDRAFT_22706
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C1 Peptidase_C1_2 Inhibitor_I29
Motif
Other DBs
NCBI-GeneID: 5888314
NCBI-ProteinID: XP_001743272
JGI: 22706
UniProt: A9URU4
AA seq 386 aa AA seqDB search
MAAAAGGGLRWLRVLVCFCGWMAVVQSDEWKESVDGTRQDFEAFLRAYNRSYPEPTAYAR
HLACFRANLAAAAGMSATAASRVAGHTARFGLNKFADRCVASERKRRAQFFMTDLNAAAR
NDRLLGSNQASCLVAPLNCSMAAAATATLPTTVDMRDMVTVINNQGECGGCWAFATAETV
EIMFRLAGNAPIGAGPLSIQQILSCTGSTENGCRGGYVDAAMQFVYDLSVSNATQGLEAA
NYSQFACATDGCAGGLPACPSLHPPFAQINSSCTCNDWTEAQMQTFIAQHGPLAIKVNAD
PWNGYQSGIIRWHCASSGSAGDHAVQIVGYGTELVDGNPIDYWIIRNSWGADWGENGYVR
IARGGNVCGKAKRNASGFTPIGQIED
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atggcagcggcagcaggaggggggctgagatggctgcgtgtgttggtatgcttctgtggg
tggatggcagtggtgcagagtgatgagtggaaggagtccgtggatgggactcgtcaggac
tttgaggcttttctccgtgcgtataatcggagttatccggagccgacggcgtatgcgcgc
cacttggcttgctttcgcgccaatctggcggcggcggctggaatgtcggccacagcagcc
agccgggtagcaggacacacagccagatttggcctcaacaagtttgccgatcgctgtgtg
gcatcagagcgcaaacggcgtgcgcagtttttcatgacggacctgaacgcggcagccaga
aacgatcgtcttttgggatcaaatcaagcctcgtgcttggtagcaccgctcaactgcagc
atggcagccgctgcaacggcaacgctccctaccactgttgacatgcgagatatggtgacg
gtcattaacaatcaaggcgagtgcggcggttgttgggcatttgcaaccgcggaaacggtg
gagattatgttccgtctggcaggaaacgcgcccattggtgccgggcccttgagcatccaa
caaattctttcttgcaccggctccacagagaatgggtgtcgcggtggctacgttgatgca
gccatgcagtttgtctatgacctcagcgtgtccaacgcaactcaaggtttggaggcggcc
aactactcccaatttgcctgtgccacggatggctgcgcgggcgggctgcctgcctgtccc
tccctgcacccgccctttgctcaaatcaactcgagctgcacttgcaatgattggaccgag
gcacagatgcagacctttattgcccagcacggaccactggccatcaaggtcaacgctgat
ccatggaacggctaccaatcgggcattatccgctggcattgtgctagttctggcagcgcg
ggagatcacgcagtgcaaatagtgggttatggtacagaacttgtcgatggaaatcccatc
gactattggatcattcgcaactcgtggggagcagattggggcgagaatggttacgtccga
attgcacgaggtggaaatgtgtgtggtaaggccaaacgcaatgcatcgggcttcacacct
attggccaaatagaagattaa

DBGET integrated database retrieval system