KEGG   Monosiga brevicollis: MONBRDRAFT_25105
Entry
MONBRDRAFT_25105  CDS       T01042                                 
Name
(RefSeq) hypothetical protein
  KO
K01763  selenocysteine lyase [EC:4.4.1.16]
Organism
mbr  Monosiga brevicollis
Pathway
mbr00450  Selenocompound metabolism
mbr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mbr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    MONBRDRAFT_25105
Enzymes [BR:mbr01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.16  selenocysteine lyase
     MONBRDRAFT_25105
SSDB
Motif
Pfam: Aminotran_5 RTP1_C1
Other DBs
NCBI-GeneID: 5890945
NCBI-ProteinID: XP_001745624
JGI: 25105
UniProt: A9UYF3
AA seq 1371 aa
MAVSRLQHALALLEDAGDEGDDGLLSGLTSENADSAQDGPSLDDLVKAREQRQQRQETDD
PAAPAAPVGSGLGSDQQTAAGQAEAVTMGDVIEVLLVRALAVLEATTCDQVGNMAGPIPQ
RTEPLHIPEDLQAAMDNVATSWDAAATLGEEANAPVVTWRFVVRLTQALASALQHEAEAL
QRRADLAHRTFFLLLRFGVLPYLPPEAAAHFAVRHPVQAAIPGLSLVVGQRTAFLTGFLQ
HLLNTGGPFAIRMVPDAFVRATLALNVTLAFQPAARRHPHRARHSQRLRRLLEALPVGAS
IDALLLLVADPAPRPPTSLPLSSTPEEEALRPTWLARAARTLLALQFARPRGVAAACRLL
MEEANDSMARDQADRAIMIICTIPKQTMFKPKDYAQAIAAQVLELLQTQPEAARPVVSAA
LFGMLGNLLQQHLDVLQPTIANALWPTLLLLEKENAKSLLTQNLSDDLKHLHEADALAAE
LRLWAQLVDLCREPAPFVRLLLPHFDAVAALAFVEQSNKGLAGATKLLGMLLQLGPQDVL
APTCAALLCDKPLMPRAHVTRTLAGEMVIQAGQDLAPNRDDFCNFILAQVRAAHRQRLKL
RILAALAERLREHTTSDEDAEGMFRAVAALHALLEDVSADLMRLPEETLQLIEVIIAIPL
PDVRAVGLNLLELLLSAQLDQLAPTGVGAQLGNEDPENEAALLAQAQELRQAIVTRAARW
SGLGSTPSSTDTPDNAGVHRKLNELAGQLAAPQIPLRAHALVEMRKFLAANPDTAQAHAT
VLAGLYLSQLKHEDSFLYLPAVNGLADLVAMTPKTMIATLLQEWATKSMSPEYRMKVGEV
LVKVCRLLGQRVKDADELVAASALSNLADMCALLRFSLAKYLTEILVLVEDLLQSESEQR
RRGALNILVVCLRSLTTDDMTRLAAELRAVRELVARSLALEQDEVARTHAALAQDELDRL
RDAYIAPLSTLTPQDLIFRLGNLTPQYVIAAITQALQDGWGNPSSAHGPGRQAKAMIQQA
RQQVADMVHATRPEQIIFTSGGTEANNWVIQDVVAQSTQRLQSQERPHVITSNVEHDSVK
NVLQHLEAQAAIDVTWVPVQSDGRVLVTDVLTAIRSNTCLITLMLANNETGALQPVGEVG
AALEDINREREQPVVLHTDAAQAIGKLDVDVAALKVDALTIVGHKFYAPRIGALFVRTRG
APVQENSSNVQTSGSDWYRIRASLYGGGQEAGDRPGTENTPMIVGLGQGAAVVRENLAAH
QAHMEAMQNRLYSGLKAFGSEQVHLNGVHEDTPRLCNTLNFSLLNSDLTGADLLAKAGIM
ASVGSACHSHLGRRPSHVLLASGVPPEIAWAVTPPPRTLTDLSMLYAKLQH
NT seq 4116 nt   +upstreamnt  +downstreamnt
atggctgtctcgcgcctgcagcatgcgctggcgttgctggaagacgcaggtgatgagggg
gatgatggactcttgtcgggcttgacgagcgagaatgcagactctgctcaggatgggcct
agcttggatgacctagtcaaggcacgtgaacagcgccagcagcgccaggagaccgatgac
cccgcagcccctgccgcgcccgttggttccggcctcggctccgatcagcagactgccgct
ggccaagccgaagccgtcaccatgggagacgtcatcgaagtgctgcttgtgcgagcgctt
gctgttctagaggccacgacttgcgaccaggttgggaatatggctgggcctatcccacaa
cggactgagcccttgcacattccggaagacctacaagcggccatggataacgtggccacc
tcctgggatgcagctgcaaccctgggcgaggaggccaacgccccggtcgtgacgtggcgc
tttgtggtgcggcttactcaagcactggcaagtgcgctgcaacacgaagcagaggccctg
cagcgtcgtgctgacctggcacatcgcaccttctttctgctgttgcgctttggtgtgctg
ccctacttgccgccggaggcagctgcacactttgccgttcgccatcctgtccaagccgcc
attcccggcctgagcctggttgtgggtcagcgtactgccttcttgactggctttctccag
caccttttgaatacagggggcccttttgccattcgcatggtccccgatgcctttgtgcgc
gccaccttggccctcaacgtgactcttgctttccagcccgccgctcgccgccacccacac
cgcgctcgacactctcaaagattgcgccgcttgctggaggccttgcctgttggtgccagc
attgacgccttgctcctactcgtggcagatccagccccgagacctccgacctcattgccg
ctcagctccacgcctgaagaggaggctctacgtccaacctggctggctcgcgctgcgcga
acccttttagcccttcagtttgcccggcctcgcggtgtggcggctgcctgccgcctattg
atggaggaagccaacgatagcatggctcgcgatcaagcggatcgtgccatcatgatcatt
tgcacaatacccaagcaaactatgtttaaacccaaggattatgcccaggccatagctgca
caagtgctagagcttcttcaaacgcaaccagaggccgcacgcccagttgtgagtgccgct
ctctttgggatgcttggcaacctattacagcaacacttggacgtgctgcagcccaccatt
gccaacgcactctggcccacccttctcctccttgagaaagaaaatgcaaaatccctgctg
acccaaaatctctcggatgatttgaaacatttgcatgaagccgatgctttggcggcagag
ctacgtctttgggcccaactggtcgacttgtgccgcgagccagccccatttgtccgtttg
ctgttgccacacttcgatgccgttgctgccctggcctttgtcgaacaaagcaacaaaggc
cttgctggcgccaccaaactgcttggcatgctgctacagcttggtccccaggatgtcctg
gcgccgacctgcgcagctttgctctgtgacaagcccttgatgccccgcgcacatgtgacg
cgaacgcttgcgggtgagatggtcatccaagccggccaggatttggcacctaaccgcgac
gacttttgcaatttcatcttggctcaagtccgagctgcgcatcgccaacggctcaaactt
cgtattttggcagctttggctgagcgcttgagagagcacacaacatcagacgaggatgcg
gagggcatgttccgtgccgtggccgctcttcacgccctgctggaagacgtcagcgccgac
ttgatgcgccttcccgaagagaccttgcagctgattgaagtgatcattgccatcccgctg
ccggatgtgcgtgctgtcgggctcaatctgctggaactgttactgagtgcccagctggac
cagttggcgcccactggtgttggagcccaactcggtaacgaggatccggaaaacgaagca
gctttgcttgcccaagcccaagagttgcgacaagccattgtcacgcgcgcggcacgatgg
tccgggctgggttccacgccatcctcaacggacacccccgacaatgccggcgtacaccgg
aagctcaacgagttggcgggacaactagcagcaccacaaattcctctgcgcgcgcatgct
ctggtcgaaatgcgcaaattcctcgccgccaatccggacacggcgcaagcacacgcaacc
gttcttgccgggctctacctatctcaactcaagcatgaggacagctttctgtatctaccc
gctgtgaacggcttggcagacttggtggccatgacacccaagacgatgatagccactcta
ctgcaggaatgggcgaccaagagcatgagccccgaatatcggatgaaggttggagaagtt
ttggtcaaagtttgccgtctcttgggccagcgcgtcaaagatgccgatgagttggtagct
gcgtctgccttgagcaatctggccgacatgtgcgcgcttttgcgcttcagcttggccaag
tacctgaccgaaatcttggtgcttgtggaggatttgctgcaaagcgagagtgagcagcgg
cggcgtggtgcactaaatatattggtggtgtgcttgcgctctctgacaacggatgacatg
acgcgactagcagctgagctgcgcgctgtgcgtgagcttgttgcacgcagtttggctttg
gaacaggacgaggtggcgcggacgcatgcagcgttggcccaagatgagctggatcgcctg
cgagacgcatacattgctcccctaagcacccttaccccacaagacctcatctttcgcctc
ggcaacctgactccgcagtacgtcattgccgccatcacccaggccctgcaggatggctgg
gggaacccgtccagtgcgcacggacctggtcgacaagcaaaagcgatgatacagcaggcc
cgccagcaagtggcggacatggtgcacgctacccgaccagaacagatcatattcaccagc
ggtggtacagaggccaacaactgggtgatccaggatgtggtagcccaaagcacccagcgc
ctacagtcccaggaacggccgcacgtcatcacgagtaacgtggagcatgattcggtgaaa
aacgtcctgcagcacctcgaggctcaggcagcaatcgacgtgacctgggtaccagtgcag
tcggatggtcgtgttttggtgaccgatgtattgacggccatccgttcaaacacgtgtctc
atcactctcatgctggccaacaacgagacgggtgcactgcagccagtgggcgaagttgga
gcggcgctagaagacatcaaccgcgagcgcgagcagcccgttgtccttcacacggacgca
gcacaggccatcggcaagcttgacgtggacgttgctgccttgaaagttgatgcgctgacc
atcgtgggtcacaagttctatgcaccccggatcggtgccttgttcgtgcggacacgagga
gcgcctgtgcaagaaaactccagcaatgttcagaccagtggcagcgattggtaccgcatc
cgcgcgagcctatatggaggaggccaagaggcgggcgataggcctggcaccgagaacacc
ccaatgattgtgggtttgggccagggggctgcggtcgtacgagagaacctggcggcccat
caagcccatatggaagcgatgcaaaatcgcctctattctggtttgaaggcctttggctcg
gaacaggtgcatttgaatggagtgcacgaggatacgcctcgcctgtgcaatacgctaaac
ttttctcttctcaactctgacttgacgggagcagatcttttggccaaggctggcatcatg
gcgtccgtgggcagtgcgtgccattcccatcttggcagaagaccatcacacgttctgctc
gcctcgggcgtgcctcccgaaattgcgtgggccgtgacaccaccgccgaggacattgacg
gatttatcgatgctctacgccaagctgcaacattga

DBGET integrated database retrieval system