KEGG   Monosiga brevicollis: MONBRDRAFT_25711Help
Entry
MONBRDRAFT_25711  CDS       T01042                                 

Definition
(RefSeq) hypothetical protein
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
mbr  Monosiga brevicollis
Pathway
mbr00450  Selenocompound metabolism
mbr00970  Aminoacyl-tRNA biosynthesis
mbr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mbr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    MONBRDRAFT_25711
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    MONBRDRAFT_25711
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mbr01007]
    MONBRDRAFT_25711
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mbr03016]
    MONBRDRAFT_25711
Enzymes [BR:mbr01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     MONBRDRAFT_25711
Amino acid related enzymes [BR:mbr01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   MONBRDRAFT_25711
Transfer RNA biogenesis [BR:mbr03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    MONBRDRAFT_25711
 Prokaryotic type
   Other AARSs
    MONBRDRAFT_25711
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1
Motif
Other DBs
NCBI-GeneID: 5891363
NCBI-ProteinID: XP_001746065
JGI: 25711
UniProt: A9V073
AA seq 445 aa AA seqDB search
MLERGYIYKGSYAGWYCRSDEAYLTSTQIEDRIGPDGTLVKVSSESGHPVELVEEENYMF
KLGALVPDVRRWVETSNVIWPPNRKAEILNMLDSKLPDLSISRPRRKLQWGIPVPHDPEQ
TIYVWVDALTNYLTAQGFPTQGAPTHPMLHVIGKDIVKFHCVYWPAFLLAAGLELPQQVL
VHGHWTMDGRKYSLRPPLVCPALQPTALPIHAIVALDPMSKSLGNVVDPVQLLDQADGVP
DLVRYYLLKESRLDTDGDFSYRRLNAVTKELADTVGNLLSRISNQRVNSALEFPGLSVDD
APPPSPCQELITLGSSVAEEVRACYDRHDFGAGIEALLPLARRCNALINELEPWKLARDD
SPAAQATLKSLLGGAFESLRVTAALLYPVTPALSLALIHRLGCDEQDLQCLTPAVPTTAR
ELRVDKQPLIPRVDFGPPAQTDTRA
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgctggaacgtgggtacatttacaagggctcctatgccggctggtactgccgatctgat
gaagcctatctgacgtcaacacaaattgaggaccgaatcggacctgatggcactcttgtc
aaggtttcaagtgagtcgggtcatccagtggagctggtggaggaggagaactacatgttc
aagctgggggcgcttgtgcctgacgttcgtcgttgggtcgagacgagcaacgtgatttgg
ccgcccaatcgcaaagccgagattctcaacatgttggacagtaaactgccagacctgagc
atctcacgaccacgacgcaagcttcagtggggcatacccgtcccccacgatccagagcag
acgatctatgtctgggtcgatgcgctaaccaactacttgacggcccaaggctttccgaca
caaggagcgccgacgcacccgatgctccacgttattggcaaggacattgtcaaatttcac
tgcgtatactggcccgcattcttgctggcggccgggttggagctaccgcagcaggtcctt
gtgcatgggcactggaccatggatggccgtaagtattccctgcgtcccccacttgtgtgt
cctgccttgcagcctactgccctgcccattcatgccattgtggctctggatccgatgtcc
aagagtcttgggaacgtggttgaccctgtgcagttgctggatcaagccgatggcgtgcct
gacttggttcgctattatctgctcaaggaatcgcgcttggacaccgatggcgatttcagc
taccggcgactcaacgccgtcaccaaggagctggccgacaccgttggcaacctgctgtct
cgcatcagcaatcaacgtgtgaactcggctttggagtttccgggcctgtccgtggatgac
gctccccccccttccccttgtcaggaactcatcacgttgggttccagtgttgctgaggag
gtacgcgcgtgctatgatcgacatgactttggtgctggcattgaagccctgctaccgctc
gcacgtcgctgtaacgccctcatcaatgagcttgagccatggaagctggcgcgagacgac
tctccagctgcgcaggccaccttgaaaagcctcttgggtggggcctttgaaagcctgcgc
gtgacggccgcgctgttgtatccggtgacaccggccctgagcttggcgctcatccatcgc
ttggggtgcgatgagcaagacttacagtgcctgaccccggcggttccaacgactgcacgt
gaactgcgagtggacaaacaacccttgatccctcgcgttgattttggtccgcctgcacaa
actgacactcgtgcatag

DBGET integrated database retrieval system