KEGG   Monosiga brevicollis: MONBRDRAFT_25953
Entry
MONBRDRAFT_25953  CDS       T01042                                 

Definition
(RefSeq) hypothetical protein
  KO
K01681  aconitate hydratase [EC:4.2.1.3]
Organism
mbr  Monosiga brevicollis
Pathway
mbr00020  Citrate cycle (TCA cycle)
mbr00630  Glyoxylate and dicarboxylate metabolism
mbr01100  Metabolic pathways
mbr01110  Biosynthesis of secondary metabolites
mbr01200  Carbon metabolism
mbr01210  2-Oxocarboxylic acid metabolism
mbr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mbr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MONBRDRAFT_25953
   00630 Glyoxylate and dicarboxylate metabolism
    MONBRDRAFT_25953
Enzymes [BR:mbr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.3  aconitate hydratase
     MONBRDRAFT_25953
SSDB
Motif
Pfam: Aconitase Aconitase_C PIH1_CS AcnX
Other DBs
NCBI-GeneID: 5891681
NCBI-ProteinID: XP_001746450
JGI: 25953
UniProt: A9V0Y4
AA seq 895 aa
MAGLGNSLTALAQLLDGNADQLDLDSPAGKGSPAAFSDPGAISRAAQPSGTQRRAQAATA
ARATTSQANNQAIFNEEDVEDAGALPDVDDPRPTPEYDIVYRQAVSSEDMYLGMSGRNPS
SAGCEEMVVKIQLPKTAFKDVTLDVKAQHLDVRTPAFCLNLPLPHPVYRSQQAGPLTAAE
KILAAHLHPEAARLDRGKYNLFYPDRVNLQDASAQTALLQFMLTRAPSVSVPTSVHCDHL
IVGSPEGADRDLALAKDQNEEVFSFLESASKRFGVAFWPPGSGIIHQIVLENYASPGMLM
IGCDSHTPNAGGLGCLAIGVGGADAVEVMSGQPWELLVPKIIGVELKGRLNKWCSAKDII
LHLAGQLTVKGGTGHIIEYFGPGTQTLSCTGMATICNMGAEVGATTSIFPYAEPQEAYLR
FTGRGAQADEANAVAHDLLRADPGCAYDQVITVDLDQLEPHFNGPFTPDLATPLSAFANQ
AREKQWPLELSAALIGSCTNSSYEDMTRAASIAQQAIDKGLTAAVPFFITPGSEQILQTC
RRDGVLDVLERAGGTVLANACGPCIGQWSRPTMEDGVPNSILSSFNRNFAGRNDGNKQTH
NFLCSPEIVTAMAFSKSLTFNPLTDSLLAADGTSFKFSPPEGESLSAAGFENNVVKPSAV
PEPDLSINVSIDPTSTRLQRLDAFAPWDGQDFQNLRVLIKVKGKCTTDHISAAGPWLKYK
GHLENISQNTLITAVNAEHDRLNSVRNYLVDGENYGTIPEVAAAYRDAGVQWIIVGDENY
GEGSAREHAAMQPRFLGCVAVVCRSFARIHETNLKRQGVFPLTFADPNDYDQLCSSDIVD
LIGLRPGEAPALRVRRSEQEEEFTVPLRHTLSPIQMDWIRSGSALNYIAQTIAAA
NT seq 2688 nt   +upstreamnt  +downstreamnt
atggcgggtcttggcaacagtttgacggcgttggcgcaattgctggatggcaatgcggat
cagctggatttagattcgccggctgggaagggttctcctgcagccttctcagacccgggt
gccatctccagggccgcccaaccctctgggacgcaacggcgggcacaggcagcgacagcg
gcgcgcgccacgacgagccaggccaacaaccaggccattttcaatgaggaggatgtggag
gatgcaggtgccctgcctgatgtggacgatccgcgccctacgccagagtatgacattgtg
tatagacaggccgtctcctcggaagatatgtatctgggcatgagcggccgcaatccttct
tcagctggctgtgaggagatggtggtcaagatccagttgccaaagacggctttcaaagat
gtcacgctggatgtcaaagcgcaacatctggatgtgcgcacccctgcattttgcctgaac
ctacctctcccccacccggtctatcgcagtcagcaggcaggccctctcaccgcagcagag
aaaatcttggccgctcatcttcacccagaggcggcacgcttggatcgcggcaagtacaac
ctcttctaccctgatcgagtcaatctccaagatgcctcagcacaaacagcactcctgcag
tttatgctcacccgcgcgccaagtgtgtccgtgcctaccagcgtccactgtgaccacctg
attgttggctcgccagagggcgcggaccgtgacctagccctggccaaggatcaaaatgaa
gaggtcttttcgttcctggagtcggcttccaagcgcttcggtgttgctttctggcctccc
ggctcgggcattatccaccaaatcgtgctcgagaattacgcctcacccggcatgcttatg
attggatgtgattcgcacacccccaacgcgggtggcctcggttgcctggccattggagtt
gggggtgcggatgccgttgaggtcatgagtggtcagccttgggagctccttgtccctaag
attattggtgtagaactcaagggtcgcttaaacaaatggtgtagcgccaaagatatcatt
ctgcatttggccggtcagctcacagtcaagggtggaacaggacatatcattgagtacttt
ggccccggcactcaaactctgagttgcacgggcatggccacgatttgcaacatgggtgcc
gaggtgggtgccaccacctccatcttcccctacgcagagccacaagaagcctatctgcgc
ttcacgggtcgtggcgctcaggccgacgaagccaatgccgtggcccacgatcttttgcga
gctgaccctggttgtgcttatgaccaagtcattactgtggatttggatcagctcgagccg
cacttcaacggacctttcactcccgatttggccacgccattgagcgcgtttgccaatcag
gcgcgcgaaaagcaatggcctctcgagctctcggcagcgctaatcggtagctgcactaat
tccagctacgaggacatgacccgagctgcctctattgcacagcaagcaatcgacaaaggc
ctgactgccgcggtccccttttttatcactccgggctcggagcagatcttgcaaacgtgc
cggcgggatggcgtcttggatgtcttggagcgtgctgggggtaccgtgctggcgaatgcg
tgtggcccatgcatcggccagtggagccgtccaaccatggaggacggcgtgcccaatagc
attctctcatctttcaaccgcaactttgctggacgcaacgatggcaacaagcagacccac
aactttttgtgttcgccggaaatcgtgactgccatggcatttagcaagtctctgacgttc
aatcccctgacagatagtcttttggcggcagatggcacttcgttcaagtttagtcccccg
gagggcgagagcctctccgcggccggcttcgagaataacgtggtgaagccttccgctgtt
ccagagccagacttgagcatcaatgtgagcattgatccaacgtcgacgcgcctgcagcgt
ttggatgcttttgctccatgggatggacaagactttcagaatttgcgtgtcctcatcaag
gtgaagggcaagtgtacgacggaccacatctctgccgcggggccgtggctcaagtacaaa
ggtcatctggagaatatctcccagaacacgctgatcacggctgtcaacgctgaacatgac
cgactcaactcagtacgcaactatcttgttgacggtgaaaactatggaacaattcctgaa
gtggccgccgcctatcgagatgcaggcgtgcagtggatcattgttggtgatgaaaactac
ggtgaggggtcagctcgcgagcacgcggccatgcagcctcgcttcttgggctgtgttgcc
gttgtgtgccgaagctttgctcgcatccacgagacaaatttgaagcgtcaaggcgtgttc
ccgctgacttttgccgaccccaacgactacgaccagctgtgctcaagtgatattgtcgac
ttgattgggttgaggcccggggaagccccagcgcttcgcgtgcgtcgctcagagcaagaa
gaagagtttaccgtgccgcttcgccacacgctcagtcccattcaaatggactggattcgc
agcggctccgctctaaactacattgcccaaaccatagcggcagcatag

DBGET integrated database retrieval system