KEGG   Monosiga brevicollis: MONBRDRAFT_26458Help
Entry
MONBRDRAFT_26458  CDS       T01042                                 

Definition
(RefSeq) hypothetical protein
  KO
K01694  tryptophan synthase [EC:4.2.1.20]
Organism
mbr  Monosiga brevicollis
Pathway
mbr00260  Glycine, serine and threonine metabolism
mbr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mbr01100  Metabolic pathways
mbr01110  Biosynthesis of secondary metabolites
mbr01130  Biosynthesis of antibiotics
mbr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mbr00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MONBRDRAFT_26458
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MONBRDRAFT_26458
Enzymes [BR:mbr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MONBRDRAFT_26458
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trp_syntA PALP His_biosynth DUF1971
Motif
Other DBs
NCBI-GeneID: 5892038
NCBI-ProteinID: XP_001746840
JGI: 26458
UniProt: A9V2F2
AA seq 676 aa AA seqDB search
MAVAIRQAFARCQRLGKPAFVGFLTAGFPTLDTTIPALVALQEGGADIIELGLPFSDPLA
DGGAIQKANTQALANGMTVPKLVQLIADARKAGVTVPIVIMGYFNPMMAYGFERFAKDVA
EAGGNGFIIVDLPPEQASSALEAINRHDLGFVPLVTPTTTDERMAKLASIGNCFIYCVSV
TGVTGARTNLAEDLPDFIARVRKHTQLPLAVGFGISKREHVVTVGQNADGAVVGSAIIAA
VDSLGPEASPADRAQQVQALIQDLTQGKTHAEGEDEAMDKIVVDGFSYGAFGGRYIPETL
VEAHEQLWEAWQEAWKDPAFHEELAHLRSKYVGGPTPLWKCERLSQACGGGEIWLKREDL
AHTGAHKINNALGQVLLAKRLNKERLIAETGAGQHGVAMATACALMGIKCVVYMGEEDTQ
RQSLNVFRMKMLGAEVVAVKSGSRTLKDAINEAMRDWVTNVRTTHYCLGSAVGPHPFPLI
VRDLQCVIGREARTEFLETTGSLPDAVIACVGGGSNAIGMFHPFVGDEGVRLIGVEAGGE
HGVEGGKHSASLVAGKPGVLHGTLTYLLQDTDGQITETHSISAGLDYPGVGPEHSFLKDS
GRAEYVAITDSEALDAFKQLSQLEGIIPALESSHAVAYGMKLAKTMKPGQRVLVNLSGRG
DKDMMTVAKVMGVQLD
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atggccgtcgccatccgtcaagcgtttgcccgctgccagcggctgggcaagcccgccttt
gtcgggtttctgaccgctggctttccgacgttggacaccaccatcccggctcttgtggct
cttcaggagggcggtgccgacatcatcgagctgggtttgcccttctccgaccctttggcc
gatggcggggctatccaaaaggccaatacccaagccttggccaacggcatgaccgtaccc
aaactggtgcaactcattgccgacgcgcgcaaggcgggtgtgactgtgcccattgttatc
atgggctacttcaacccgatgatggcctacggcttcgagcgctttgccaaggacgtagct
gaggctggtggcaacggctttatcattgtagatctgccgcccgagcaagcaagcagtgcc
ttagaggccatcaatcgccacgatcttggctttgtgccgctggtgacacccaccacgacg
gatgaacgcatggccaaacttgcctccattggcaactgcttcatttactgtgtgagcgtt
actggcgtaactggtgcgcgcaccaatttggctgaagacttgcccgactttattgcccgt
gtgcgcaagcatactcaattgcctctggccgtgggctttggcattagcaagcgtgagcac
gtggtcacggtcgggcaaaatgctgatggcgctgttgtggggtcggcgatcatcgccgcc
gtggatagccttggtcctgaggcttcaccggcggatcgggcacaacaagttcaagctctc
atccaagacttgacgcagggcaagacccatgccgagggtgaagacgaggcgatggacaag
attgtggttgatggcttcagctatggtgcttttggggggcgctacatccccgagaccctg
gttgaagcccacgagcagctctgggaggcctggcaggaggcttggaaggacccagctttc
cacgaggaactggcgcaccttcgctcgaaatatgttggtggacccacacccctttggaag
tgtgagcggctcagccaagcctgcggcgggggtgaaatttggctcaagcgtgaagatttg
gcgcacaccggtgcgcataagattaataacgcgttgggccaggtgctgctcgccaagcgt
ctcaataaggagcgattgatcgccgagactggtgccggtcaacatggagtggccatggcg
acggcctgcgcccttatgggcatcaagtgtgtcgtgtacatgggtgaagaagacacgcaa
cgccagtcactcaacgtctttcgaatgaagatgctcggggccgaggtcgtggctgtcaag
tctgggtcgcgcacgctcaaggatgctatcaacgaggccatgcgtgattgggtgaccaac
gtgcgcaccacccattactgcctcggatcggctgtgggcccacatccttttcccttgatt
gtacgcgacctgcaatgcgtcattggtcgcgaagcgcgcacggagtttttggagaccaca
ggttctctgcccgatgcggtcattgcttgcgttgggggtggttccaacgccatcggcatg
ttccatccctttgtcggggacgaaggtgtgcgcttgatcggcgtggaggctggtggtgag
cacggcgtggaagggggcaagcactcggcctccctggtcgcgggcaagcccggtgtgctg
cacggcacgttgacctacctcttgcaggacacggatggacaaatcacggagacgcatagc
atctcggccggtctcgactacccgggtgtgggcccagagcactccttcctcaaggatagt
ggccgagccgagtatgtggccattacggacagcgaggccttggatgccttcaagcagttg
tcgcagctggagggtatcatcccagctctcgagtcgagccacgccgtggcctatggcatg
aagttggccaagacgatgaagcctgggcagcgcgtgctggtcaacctttcgggccgtggc
gataaggacatgatgactgtggccaaggtcatgggagtgcagctggattga

DBGET integrated database retrieval system