KEGG   Monosiga brevicollis: MONBRDRAFT_26581Help
Entry
MONBRDRAFT_26581  CDS       T01042                                 

Definition
(RefSeq) hypothetical protein
  KO
K14811  ATP-dependent RNA helicase DBP3 [EC:3.6.4.13]
Organism
mbr  Monosiga brevicollis
Brite
KEGG Orthology (KO) [BR:mbr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:mbr03009]
    MONBRDRAFT_26581
Enzymes [BR:mbr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     MONBRDRAFT_26581
Ribosome biogenesis [BR:mbr03009]
 Eukaryotic Type
  Pre-60S particles
   Helicases
    MONBRDRAFT_26581
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DEAD Helicase_C ResIII SR-25
Motif
Other DBs
NCBI-GeneID: 5892346
NCBI-ProteinID: XP_001747140
JGI: 26581
UniProt: A9V2S5
AA seq 545 aa AA seqDB search
MARKLSKKEKKQKRQALEAASTAASAAAAPEAKRAKAADHEHVHEHAPVEVKEKKEKKEK
KNKKEKKNKKDKKAKTTPAAASAAPTPAAGATPSVKKADRKAIDALWKEFNVTIEAGEGH
DAYAFPPAMTFADAGVDADLMACTKGFDKPTAIQSCCWPIVVQGQDLVGVAATGSGKTLA
FTLPALQHVKGLGRSKTNCPRVLVLSPTRELALQINKVAQDAVKSLNQISAVCVYGGASK
RDQLTALRQGCELVIATPGRLVDFLNDGKLDLSHVSYLVLDEADRMLDMGFERDIKLILG
AVGTQRQTLMFSATWPEEVRAIAANYMKNPLRVTVGSEELSANRNVKQVVDVVEPMEKDR
RLLDVLRKHPASKNAKVLIFALYKKEAARLESFLQRKSYNVVGMHGDLNQGQREAALRAY
KSGDSHILIATDVAARGLDVKGVAVVINYTFPLTIEDYVHRIGRTGRAGATGIAYTFFTQ
HDKAHAGALGNVLREADVEVPEALMKFGQHTKRKEHALYGAHFKADNGPPMKEAKRITFD
SDDEE
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgcaagttgagcaagaaggagaagaagcaaaaacgccaggcgcttgaggctgca
tccaccgcggcgtcggctgccgctgcccccgaggccaagcgcgccaaggccgcggatcac
gaacacgtccatgaacacgcccctgtcgaggtgaaggagaagaaggaaaagaaggagaag
aagaacaagaaggagaagaagaacaaaaaggacaaaaaggccaagaccacccccgcagcc
gcgtcggctgccccgactcccgcagctggtgccacgccatcagtgaaaaaggccgaccgc
aaagccattgatgcgctctggaaggagtttaacgtcaccattgaagctggcgagggtcac
gacgcttacgccttccctccggccatgacctttgccgacgcaggcgtcgatgccgacctc
atggcctgcaccaagggctttgacaagcccactgccattcagagctgctgctggcctatt
gtcgtccagggtcaagacctggtcggcgtggccgcaacgggatccggcaaaactctggcc
tttacccttcccgccctccagcacgtcaagggtcttggtcgcagcaaaaccaactgcccc
cgcgttctcgtcctctccccaacccgcgaactcgcccttcagatcaacaaggttgctcaa
gatgctgtcaagagtttgaaccagatcagcgccgtgtgcgtgtacggtggtgcttcgaag
cgcgaccagctcaccgcccttcgtcaaggctgcgagctcgtcatcgccaccccgggccgt
ttggtggactttctcaacgacggcaagcttgatctcagccatgtctcctaccttgtcctc
gatgaagccgatcgcatgcttgacatgggatttgaacgcgatatcaagctcattcttggc
gccgtgggcacccaacgacaaacgctcatgttttccgcaacgtggcccgaggaagtgcgc
gccattgccgccaactatatgaaaaacccgctgcgggtgaccgtgggctctgaggagctc
tcagccaaccgcaatgtcaagcaggtggtcgatgtggtcgagcccatggaaaaggatcgc
cgcctcctcgatgtgcttcgcaagcaccccgcctccaagaatgccaaggtactgattttt
gccctgtacaagaaggaggctgcgcggttggagagctttctgcagcgcaagtcatacaat
gttgtgggcatgcacggtgacttgaaccagggtcagcgcgaggcagctcttcgggcctac
aaatctggcgattcacacatcctcattgccacggacgtggccgcgcgtggcctcgatgtc
aagggggtggctgtcgtcatcaactacacatttccgctgacgattgaggactatgtgcac
cgcattggtcgcacggggcgtgccggtgccacgggtattgcctataccttttttacccag
cacgacaaagcgcatgcaggagcgttgggcaatgttctgcgcgaggccgatgtcgaggtg
cccgaggctttgatgaagtttgggcagcacaccaagcgcaaggagcacgccctgtacggc
gcgcactttaaggccgacaacgggccacccatgaaggaggccaagcggattacttttgat
tcggacgatgaagaataa

DBGET integrated database retrieval system