KEGG   Monosiga brevicollis: MONBRDRAFT_27243Help
Entry
MONBRDRAFT_27243  CDS       T01042                                 

Definition
(RefSeq) hypothetical protein
  KO
K08056  protein disulfide isomerase family A, member 3 [EC:5.3.4.1]
Organism
mbr  Monosiga brevicollis
Pathway
mbr04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mbr00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    MONBRDRAFT_27243
 Human Diseases
  Infectious diseases
   05163 Human cytomegalovirus infection
    MONBRDRAFT_27243
Enzymes [BR:mbr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     MONBRDRAFT_27243
Chaperones and folding catalysts [BR:mbr03110]
 Protein folding catalysts
  Protein disulfide isomerase
   MONBRDRAFT_27243
Membrane trafficking [BR:mbr04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    MONBRDRAFT_27243
Exosome [BR:mbr04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   MONBRDRAFT_27243
  Exosomal proteins of colorectal cancer cells
   MONBRDRAFT_27243
  Exosomal proteins of bladder cancer cells
   MONBRDRAFT_27243
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin Thioredoxin_6 Thioredoxin_2 OST3_OST6 AhpC-TSA Thioredoxin_7 Thioredoxin_8 Redoxin
Motif
Other DBs
NCBI-GeneID: 5892910
NCBI-ProteinID: XP_001747756
JGI: 27243
UniProt: A9V4Q6
AA seq 466 aa AA seqDB search
MKAVLVLGLALLVALAAAEDVITLTESNFESTLKQHDLAVVEFFAPWCGHCKRLAPEYEK
AAGILKKSDTPVALAAVDATEHGSLASRFGVTGYPTLKIFRKGELSADYQGPRDAAGIVK
YMEKQAGPSSKRKCFLIDNASMFSSLDSGMARAFLKTADAERENFRFAHTTQSKALGQYG
KDVVVVFRPQKLSNKFEEGHVVYSGKAKNTLIKEFIMDAITSPGGIMTPDHRPFFFASKP
LLVVYYDLDVKMNPSRAKYIRNRVLKVAQDVTSDLTIAVANKADFAQDVQQLGLDEFSVA
AGIWGEGSTKYRLDEEWSMDAMRQFIADFEADKLESHVKSEANPEPDGDVVVATGKTIDE
ILNAPGKDVLIEAYAPWCGHCKKLAPVFSELATKFKDEDSVTVAKIDATANDLPASLPVS
GYPSIFWVPADSKKPEKYSGGRELKDFTQFIKSRASGLSKKVKDEL
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcggtgttggtgctgggcttggccctgctggtggccctggcggctgctgaagat
gtgattacgctcacggagagcaactttgagtcgaccctcaaacagcatgacctggctgtc
gttgaattctttgccccttggtgcggtcactgcaagcgtctggctcccgagtatgagaag
gcggctggtatcttgaaaaagtcggacacgccagtagctctggctgcggttgatgccacc
gagcacggatcgctggcttcccgttttggcgtcactggctaccccactctcaagatcttc
cgcaagggtgaactcagtgccgactaccaaggccctcgcgatgccgctggcattgtcaag
tacatggagaagcaagctggtccctccagcaagcgtaagtgcttcctcatcgacaacgcc
agcatgttctctagcctggacagtggcatggcacgcgccttcctcaagacggcagatgcg
gagcgcgaaaacttccgcttcgcgcacaccacccaaagcaaggctttgggacagtacggc
aaggatgttgtggttgtcttccgcccccagaagctgagcaacaagtttgaagagggtcac
gtcgtgtacagcggcaaggccaaaaacacgctgatcaaggagtttatcatggatgccatc
acttctcctggtggcatcatgaccccagatcaccgccccttctttttcgcctccaagccc
cttttggtggtgtactatgatctcgatgtgaagatgaacccatctcgcgccaagtacatt
cgcaaccgcgttctcaaggttgcacaggacgtgacttcagatttgaccattgccgtggcc
aacaaggccgactttgctcaggacgtgcaacagcttggcctggatgagtttagcgtggcc
gccggtatctggggcgagggctcgaccaagtatcgtttggatgaggagtggagcatggat
gccatgcgccagttcattgctgattttgaagccgataagctcgagtcacacgtcaagtca
gaagccaaccccgaacccgatggtgatgtggtggtggccactggcaagaccattgatgag
attttgaacgcacctggcaaggacgttctgattgaggcttatgcgccctggtgtggccac
tgcaagaagcttgctcccgtctttagcgagcttgccaccaagtttaaggatgaagacagc
gtcaccgttgccaaaatcgatgccacggccaacgaccttccggccagcctgcccgtgtca
ggctatccttcaatcttctgggtgcccgctgacagcaagaagcccgaaaagtactcgggt
ggtcgcgaactcaaggactttacccaattcatcaagagccgtgcttcgggcctcagcaag
aaggtcaaggacgagctctaa

DBGET integrated database retrieval system