KEGG   Monosiga brevicollis: MONBRDRAFT_27474Help
Entry
MONBRDRAFT_27474  CDS       T01042                                 

Definition
(RefSeq) hypothetical protein
  KO
K06037  O-phospho-L-threonine phospho-lyase [EC:4.2.3.-]
Organism
mbr  Monosiga brevicollis
Brite
KEGG Orthology (KO) [BR:mbr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MONBRDRAFT_27474
Enzymes [BR:mbr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.-  
     MONBRDRAFT_27474
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-GeneID: 5893211
NCBI-ProteinID: XP_001747875
JGI: 27474
UniProt: A9V5D5
AA seq 543 aa AA seqDB search
MAMAAMLDLCHLPHMHARSLCVCVSLCLCLSLFVFVSVAVSLSFCLSLPLSLSLSLSLSL
SLSLCLCLSLFQTDLEADTDKRHWQRCGGMLMPEAIPQLTADELRHWSTLGYGELCFAFL
RKMIDPAELEDDELRGIIAQSTAVFAHPDVTPVHTLNTDRVAGASCSQLHVCELWHGPTL
AFKDLGLQILGNLLEHFLARRKDRLNVVVGTSGDTGSAAIEAVRGRDHLQLFVLFPHGRI
SHIQELQMTAGAESASNVHVWGMDGTSDDLDQPITAVFQDTAFKARHHLGSLNSVNIVRV
LVQAVHYFYLYFRVTQDSTAQTRVDSPEFGSVWCQAPLRVFVPTGAGGHVTGGLLARLMG
LPVRLGVATNANDLLVRLLTKSTLALAPEVQVTTSPSMDIQVPYNIERIFHLVYGDASLV
QRLMQGFYADGHADVPADFLTRLGQMVDLTAVSVPDDQVLATIKAVWSTEGYPLDPHTAV
GVAAALAFEREETVPRGAMACAHPAKFVETFAQVEYSVISRDQDWSVALRTWIQRHDEAS
LTP
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atggccatggccgccatgcttgacctctgccatcttcctcacatgcacgcgcgcagcctc
tgtgtgtgtgtgtctctgtgtctctgtctctctctgtttgtgtttgtgtctgtggctgtg
tctctctctttttgtctgtctctgcctctgtctctgtcactgtctctgtctctgtctctg
tctctgtctctctgtctctgtctctctctcttccagaccgatcttgaggctgacactgac
aagaggcactggcagcgatgcggcggcatgttgatgccggaagcgatcccgcagctgaca
gccgacgagctccgccactggagcacgctggggtatggggaactctgctttgcatttctt
cgcaagatgattgatccggcagagctggaggatgacgagctcagaggaattattgcgcaa
agcacggccgtgtttgcacatcccgacgtgacgcccgttcataccctcaacactgatcgg
gtggctggagcttcgtgctcgcaattgcacgtgtgtgagctttggcatgggccgacactc
gcctttaaagatctaggccttcagattctgggcaacctgctcgagcatttcttggcacga
cgcaaggatcgcttaaacgtggttgtgggcacgtcaggtgataccggttcggccgccatt
gaggctgtgcggggtcgcgatcatctgcagctctttgtcctctttccacatggccgcatc
tcgcatattcaggagcttcagatgacagccggcgcagaatcggcatccaacgtgcatgtg
tggggcatggatggcacctccgatgacttggaccagcccattacagctgtatttcaagac
accgcattcaaggcccggcaccaccttggcagcctgaacagcgtcaacattgtgcgtgtc
ctcgtacaggccgtccattatttttacctttattttcgcgtcacgcaagactcgacggca
caaacgcgcgtcgactcaccagagtttgggtcggtttggtgtcaggcaccgcttcgcgtg
ttcgtgcccacgggggctggcgggcatgtcacgggcgggcttttggcacggctaatgggc
ttgccggttcgcctcggtgtggccaccaatgcgaacgatctgctagtgcgtttgcttacc
aagagtacattggcattggcacccgaggtccaagtcacgacttcaccgagcatggacatt
caagtgccctacaacattgagcgcatctttcaccttgtttatggcgacgcttcattggtg
cagcgtttgatgcaaggattttacgctgacgggcatgctgatgtgccagccgactttctt
actcgactgggacagatggtggacttgacggctgttagtgttcccgatgaccaggtcttg
gcgacgatcaaggccgtgtggtcgaccgagggctatccgttggatccacatacggcggtg
ggtgtagctgcggcgctggcctttgagcgtgaggagacggtgccgcggggcgccatggct
tgtgcccacccagccaagtttgtggagacatttgctcaggttgagtactcggtcatctca
cgggaccaggactggagtgtggccctccggacctggatccagcgccatgacgaggcatcc
cttacgccctaa

DBGET integrated database retrieval system