KEGG   Monosiga brevicollis: MONBRDRAFT_27890Help
Entry
MONBRDRAFT_27890  CDS       T01042                                 

Definition
(RefSeq) hypothetical protein
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
mbr  Monosiga brevicollis
Pathway
mbr00480  Glutathione metabolism
mbr00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:mbr00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    MONBRDRAFT_27890
  Metabolism of other amino acids
   00480 Glutathione metabolism
    MONBRDRAFT_27890
Enzymes [BR:mbr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     MONBRDRAFT_27890
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-GeneID: 5893616
NCBI-ProteinID: XP_001748328
JGI: 27890
UniProt: A9V6S1
AA seq 143 aa AA seqDB search
MASTASTNPDPKEAKSIFEFAAEDINGKPFSFQTLEGKVVMIVNTAGQCGLAQRNFTEMV
ELHDKYKDQGFEIVAFPSNSFNQIAVNGSDTHPLYTYLKGASPGWLTNSLKWNFTKFLCD
RTGVPRKRFGPQEAPSTMATDIE
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcacggcatccaccaacccggatccaaaggaggccaagtccatctttgagttt
gcggcggaggatatcaatggcaagcctttttcatttcaaacgctcgagggcaaggtggtg
atgattgtaaacacagccggtcaatgtgggttggcccaacgaaattttacggaaatggtg
gagctgcacgacaagtacaaggaccagggctttgaaattgttgcctttccctccaactcc
tttaatcagattgctgtcaacggctcggacacgcatcccctttacacgtatctcaagggt
gcttcgccgggctggttgaccaatagcctgaaatggaatttcacaaagtttttgtgtgat
cgcactggcgtgccgcgcaaacgattcgggccacaggaggccccctccaccatggcgaca
gacattgagtag

DBGET integrated database retrieval system