KEGG   Monosiga brevicollis: MONBRDRAFT_30343
Entry
MONBRDRAFT_30343  CDS       T01042                                 
Name
(RefSeq) hypothetical protein
  KO
K18439  Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1
Organism
mbr  Monosiga brevicollis
Pathway
mbr04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:mbr00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    MONBRDRAFT_30343
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mbr04131]
    MONBRDRAFT_30343
Membrane trafficking [BR:mbr04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    MONBRDRAFT_30343
 Endosome - Golgi transport
   Arf GTPase associated proteins
    MONBRDRAFT_30343
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    MONBRDRAFT_30343
SSDB
Motif
Pfam: PH RhoGAP ArfGap PH_11 SAM_2 PH_9 SAM_1 PH_8 PH_6 PH_2
Other DBs
NCBI-GeneID: 5896115
NCBI-ProteinID: XP_001750836
JGI: 30343
UniProt: A9VDP9
AA seq 1511 aa
MDLTTWLTSLKLEEYGALLEHHGITSIHQLSILTEEQLITMGMDKIGHRRRLLKNAKELM
APSVQPASTQAQPPVVPTKTKAPPPVPPKSRGPSTSTEQNDSDSAPPPLPRKAGSLRPTP
ALAQEEKKLQPRSKSPIMPPSRPPPPRDSAPVPVSAAATAPPAVPRKTRPSDSSTRGPAL
LPPSNRAAPPPSLHATPVPKPSRPPPPAESAPARPSPPSDPAPARPQREDSTRSTTSTTS
GNASTPATPLSPKAPPPLPSPPPPGRPQPPKLPTRTSGPDVHRNEFAAPSDDDEGSYIML
PRLPSDASQLRRVSIGQRRESSLLPSSMTREQAAMLTERSAAAPRTLQKRSKVDSHATKE
GWLLKRGGATGRKGWDRRYCVYKEGVLSYFVGDKETRPQGCIALTEMKAIRHDTGHKNRF
ELDTYERTFIFKAESPEEMTSWMMFLGSQIQLFKPKPTAGGSMADPDKEGYMRHACGAMG
WARRYIALKDGQLCLYETYQDFKDENPVDRINTMLITVKVRSRSGRKARNHQFKLVDSQQ
RHIEFQAASDQELRDWTQAIQNSILWSLNQLDSAATSHKKQTKSVVDTIRPDEAMKIIRE
NTSNLRCADCSTANPDWASINLGTMVCIDCSGVHRSMGVHISKVRSATLDDWPRDSLEVM
KALGVKLANTIWEGNLPEGVKPNMNSDRPTKEDFIRRKYEKHEFVKFWHDPARDINEQLC
AAVQQSELLDTAMLLAAGADPKAQEANTGHSALYLARRAKRSLQAALLSLNGAVLSADEQ
QSLNASVQSASSTDGNVFGPGATDDDDEGEDVDFPAPTPTQFEGPLALFDSRSATLTPYD
ALYEMGVLRLSPQEASTTGAGTPEGAPTAMEIPLQSLKTAQATTAADILNSYGHGQAQSA
NNENLRSVLAAEHGYLCVTTLSSRRFVLQTETPEQARTWAECLQANIDAIPLGDRGFDFE
NCSFVGHLQIHQEGVGYKQRYFALQGKALSYFLSQTDPNQNEIDLSNFYDVVAGLASRGV
DGKLETSKSRVDLTLVGVHDLVVLRANTEEVRDEWFRHLKATQVFGAELESSPTLVPRVV
DMCCSFIETRGLFEEGIYRVPGNAATMRRLRQAFNMDDTSVKLDPAKVSATDVAGLLKQY
FRQLPESLFPRALYDGFLDTMRIADHEQRLYNLKHYIEQLPPAHYQTLRRLCAHLAVVAE
HAASNKMTTTNLAGVFAPSLMHVQTDNEAPPGDVALMAKEYKCLEACITYHEWLFNMEQK
SDHDLMLKAGRLKIEAAKQAHEQALSTKKGTGNLAEFIFEIEDEIHDTSHTFPLSSETVA
SEVLATLCERQGSEVQPGLAVVEVVNELGLMRPLAAWESLFAASARWRGPFHFKIQNNPF
DAILHSALGAQSPSTWLHIRSVDMETGNGIGRGSGFRRCYARIETTGADGPGSIVVFKDE
TLAQELGRFALDSAIRVYSLTRPRKLPTPFSFVLLRVTASAYHETVICADSQVELEQWFG
HCTVLNQANLQ
NT seq 4536 nt   +upstreamnt  +downstreamnt
atggacctcacaacttggctcacctctctcaaactggaggaatatggcgctctgctcgag
caccatggcatcacctcgatccatcagctctccatcttgactgaggaacaactgattacc
atgggcatggataaaattggccatcgtcgtcgcctcctcaaaaatgccaaagaactgatg
gccccttcggtccagcccgcttctacacaagctcagccccctgtcgtacccaccaaaacc
aaggctccgccacccgttccccctaaatcccgaggcccctcaacgtccacagagcaaaac
gatagcgattccgcccctcccccactgccccgcaaagctggatccctgcgccccacccca
gcactggcgcaagaggagaaaaagcttcagccccgctccaaatcgcccatcatgcctccg
agtcgccccccaccccctcgcgactccgcccccgtgcccgtgtctgcagccgccaccgct
ccaccggccgtgccccgaaaaactcgacccagcgactcttcaactcgaggccctgctctc
ttgccgccctcaaatcgtgctgcaccccccccctcacttcacgctaccccagtgcccaaa
ccttcgcgcccacccccgccggccgagtcggccccagcacgcccctccccgccttcagat
cccgccccagctcggccccagcgcgaggactctactcgcagtaccaccagcactaccagt
ggcaacgcaagcacccccgcaaccccgctttcacccaaggcacccccgcccttgccctct
cccccacccccaggccgcccccagcccccgaagctcccgactcgcacctcgggtcctgat
gtccaccgcaacgagtttgccgctccctcggacgatgatgagggctcgtacatcatgttg
ccccgcttaccctccgatgcctcgcaattacgccgggtgtcgattggacaacgtcgagag
agctctctattgccctccagcatgacgcgagaacaagccgctatgctcaccgagcgctct
gctgccgcacctcgcacgttgcaaaaacgctccaaggtggactcacacgccaccaaggaa
ggctggctcttgaagcgcggtggtgccactggccgcaagggctgggatcgacggtattgc
gtgtacaaagaaggcgtgctgtcctattttgtcggagacaaagagactcgccctcaaggg
tgcatcgccctgacggaaatgaaggccattcgtcacgatactggccacaagaatcgtttc
gaactcgatacctacgagcgcaccttcatcttcaaggccgaatctcccgaggagatgacg
tcatggatgatgttcttgggctcgcaaatccagctcttcaagcccaaaccgaccgcggga
ggcagcatggccgacccagacaaggaagggtacatgcggcacgcttgcggggccatgggc
tgggcacgtcggtatattgctttaaaagacggccaactctgtctctacgagacgtatcag
gacttcaaggatgagaatccggtggaccgcatcaataccatgctgattacagtcaaggtg
cgctcgcgatctggccgcaaagcgcgcaaccatcagttcaagttggtggatagccagcaa
cggcacatcgagttccaagctgcatcagatcaggagctacgtgattggactcaggcaata
caaaactccattctctggagtctcaaccaactcgattccgctgccacctcccacaagaag
cagaccaagagtgtggtcgatacgatacgccccgacgaggcaatgaaaatcattcgtgaa
aacaccagcaacctgcgctgtgctgattgcagcacggccaatccagactgggcctcaatc
aatctcggtaccatggtctgcattgattgttcgggcgttcatcgtagcatgggcgtgcac
attagcaaggtgcggtctgccacgctggatgattggccgcgcgattctcttgaggtgatg
aaggccctcggtgtcaaactggccaacaccatttgggaaggcaacttgcccgagggggtc
aaacctaacatgaatagcgaccggcccaccaaggaggatttcattcggcgcaaatatgaa
aagcacgaatttgtcaagttttggcatgatccggctcgggacattaatgaacaattgtgc
gcggcggttcagcaatcagaactgctggacacggccatgttactagcggccggtgccgat
cccaaagcacaggaagccaatacgggccacagcgctctgtatctcgctcgtcgtgccaag
cgctcgctccaagcagcactgctctcgctcaatggcgccgtactgagtgccgacgaacag
cagagcctcaatgctagcgtacaaagcgcctcctcaacggatggaaacgtctttggacct
ggcgctactgacgatgacgatgagggcgaggatgtcgattttcctgccccaacacccacc
cagtttgaggggcccctggccttgtttgacagtcgcagcgctactctgaccccgtatgat
gccctttacgagatgggcgtgctgcgcctcagccctcaagaggcctccacgaccggtgca
ggcactcccgagggcgcgcccacggccatggaaattcccttgcagtcgctcaagacggcg
caggccaccacggccgcagatattctgaacagttatggccacgggcaggcacagtccgcc
aacaatgaaaacttgcgttctgtcctcgcagccgagcatggctacctgtgtgtcaccacg
ctgtcaagtcgccgctttgtgctgcaaacggaaacgccagagcaggctcgtacctgggcc
gagtgtctgcaggccaacattgacgccattccgctgggcgatcggggattcgactttgaa
aattgcagctttgtgggccacctgcagattcatcaagagggtgtcggctacaagcagcgg
tactttgccttgcagggcaaggctctgtcctactttctttcgcaaacagacccaaaccag
aacgagattgacctgtcaaacttctacgatgttgtcgcgggtctggcgagcagaggtgtg
gacggcaagctcgagacgagcaagtcccgggttgatctcacgctggttggtgtccacgac
ttggttgtactgcgcgccaatacggaggaagtgcgggacgagtggttccgccatctcaag
gcaacccaagtctttggtgcggaactcgagagcagcccgactctggttccgcgcgtggtg
gatatgtgttgctccttcattgaaacgcgtggcctctttgaggagggcatctaccgcgta
cctggcaacgctgccaccatgcgccgcctccgccaggcctttaacatggacgatacgagc
gtgaagctggatccggccaaagtatcggccaccgacgtggctggcttgttaaagcagtac
tttcgccagctgcccgagtccctttttcctcgtgcactttacgacggctttttggacaca
atgcgcattgccgaccatgagcaacggttgtacaacctaaaacactacattgaacagctg
cccccggcccattaccagaccctccgtcgcctgtgcgctcatctggctgtggttgcggag
catgcggcctcgaacaagatgaccacaaccaacttggcaggggtgtttgcgccctcgctc
atgcatgtgcaaactgacaacgaggcaccaccgggcgatgtggcgctcatggccaaggag
tacaagtgcttggaagcatgcatcacctaccacgagtggctgttcaacatggagcaaaag
tcagaccacgatctcatgctcaaagctgggcgcctcaaaatcgaggctgccaagcaggcg
catgagcaggcactttcgaccaaaaagggtaccggcaacctggccgaattcatttttgag
attgaggacgagatccacgatacctctcacacctttcccctgagcagtgagacggtagca
tcagaggtgctggccaccctgtgtgagcggcaaggcagcgaggtgcagcctgggttagcc
gtcgtggaggtggtcaatgagctcggcttgatgcgtccgctcgcggcctgggagtcgctt
tttgcagcctcagctcggtggcgaggaccctttcatttcaaaattcagaacaaccccttt
gacgccattctacactcagccctgggtgctcagagcccttcgacttggctgcacattcgc
tccgtcgacatggaaacaggcaatggcatcggccgtggcagcggctttcgtcggtgttac
gctcggatcgagacaacaggggccgatggcccaggaagcattgtggtcttcaaggatgaa
acactggcgcaggagttgggtcgctttgcgttggacagcgctattcgcgtgtacagcttg
acgcggccacgcaagcttcccactcctttctcctttgtattgcttcgagtcacagccagt
gcctatcacgagactgttatttgtgcggactcgcaagtggagttggagcagtggtttggg
cattgcacggtcctgaaccaggctaacttgcaatag

DBGET integrated database retrieval system