KEGG   Monosiga brevicollis: MONBRDRAFT_31509Help
Entry
MONBRDRAFT_31509  CDS       T01042                                 

Definition
(RefSeq) hypothetical protein
  KO
K14289  exportin-5
Organism
mbr  Monosiga brevicollis
Pathway
mbr03013  RNA transport
Brite
KEGG Orthology (KO) [BR:mbr00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    MONBRDRAFT_31509
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mbr03016]
    MONBRDRAFT_31509
   03036 Chromosome and associated proteins [BR:mbr03036]
    MONBRDRAFT_31509
Transfer RNA biogenesis [BR:mbr03016]
 Eukaryotic type
  tRNA transport factors
   tRNA export factors
    MONBRDRAFT_31509
Chromosome and associated proteins [BR:mbr03036]
 Eukaryotic type
  Gene silencing
   microRNA pathway
    Other miRNA pathway proteins
     MONBRDRAFT_31509
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Xpo1 IBN_N
Motif
Other DBs
NCBI-GeneID: 5889103
NCBI-ProteinID: XP_001743945
JGI: 31509
UniProt: A9UTN3
AA seq 1199 aa AA seqDB search
MNPAASSLAKQQALQYCDEFKATAPACPRVGLYLASIQEPSLLQRTHDPTIRFFGLQLLL
HCIQYRWNDYQPEEKEEMKTVICSQLLVNGTLPLGEEQTFVLLKVGSVVAKMATREWPQQ
WPALIPQLLRNADESLTARFLSMACLKSLIEDTNSFNDDLLPRRRKELTQGLTACLDEII
PFATTTLAGCLAQHSQHEGLQAEQYELTLGITLETWIVLVEWIPFEKLFASGVLPLFCQL
LHVERHRQLAADALLIVMNRKGPKHDRLALLDLFQHMDVLLQAVPQWDAGGHAADEEAYN
FIKRLAQIVVALATDQLCPLWSRNNGPYKHAPPTFESYLSALIALTRHPSELVCSLTVPA
WMALLNHDDACREKVLQDVQPYLLHDAFLRLMRGGGLEEDDSPGSEFAQQDFGDQEEYKA
FFGLFRGKLLDVVRAIGRNQPAASLEFALNQLSVVMSTPPDSVDGRVLFNSWDGIAVFWD
AIVAVAYPTINGEGRRGRNEALIEQLKNCLAALLDWSCANPLLMEAELTVLGALLPVLEH
APQALRLMLEKLFNAMEYQAQEDYVRLNEAALQSSTHTGLTDGAKVRRKAGQILKSLCQR
PPPSFTDTVQGIIGRVQQLLSQVEIGEMQRRLLIEALVVSFNSLGDDVQEQSLLGFFQPI
LAEWCHEENTRMLSSVNALIGAGGLNSGESYPQAQATRLRLTMSVNAFLSAVRDTAPRGS
AGVDASTVAGAVLHGRASSAGIGAAHGDLATLSGLHGDATGGNGLQYPALSLLHQTLPNV
LRLCNTLHHLEVAPAANNMLSADPSTLPPGMAVLLDLRRSDVHAILAASLDSASRDMTAQ
ELWMDRARLWLFNLRESCYRILGCTFRYGVLYGADDQAVFQQACVEVISGLRKRDLRLFW
KLTVYPFLRYLPRDPTIKGHAVQTAAAIILQTCHRLSASMLAAQQGTGGSTGPRELSSEE
LTPEQREILEEKLDVDLMETVIITLDHLTADVKLQREETIEDKFYHQPELGPSAWAILAD
HSCGEALLVFLCQSLAGRHASQANKACATLLRLVPALASHDVYSPGLATLVPSALLDALA
AHGEHHDNLTNLLLLAGKCLLWLGVHPACQSTFMTVPDINADHLMETYNMLQNRELRNTK
PIRLRMKSLLDGTIGVNVGQVYNARPKVLDLPQKLVLARQPTADEDDDPDLQISALFDE
NT seq 3600 nt NT seq  +upstreamnt  +downstreamnt
atgaatcctgctgccagttccctggcgaagcaacaagccctccagtattgcgatgagttc
aaggccacggcaccagcttgtcctcgcgttggtctttatctggccagcatacaggaacca
tccttgcttcagcgtacccacgatcccacgatccgtttctttggccttcagctcttgctt
cactgcattcaatatcgctggaatgactaccagccagaggagaaagaggagatgaaaaca
gttatttgcagtcaactgctggtgaatggcacgctaccattgggcgaagagcaaactttt
gttctgctcaaagtcggctcggtcgttgccaagatggctacccgcgagtggccacaacaa
tggccagcgctcattccacagctacttcgcaacgccgacgaaagtttgacagcacggttt
ttgagcatggcttgcctcaagtcactcattgaggacaccaactctttcaatgacgatctg
ttgccgcgtcggcgaaaagagctgacgcaagggctgacggcgtgcttggatgaaattatt
cccttcgccactacgacgctcgctggttgcctcgctcagcactctcagcacgaagggttg
caggccgagcaatacgagctgacgcttggcatcacgttggagacttggatcgttcttgtc
gagtggattccctttgaaaagctctttgcctctggcgttctgccgctgttttgccagctt
ctgcatgtggagcgacaccgtcaattggccgcggatgccctgcttatcgtcatgaatcgc
aaaggacctaaacacgatcgccttgccttgctcgacctcttccagcatatggatgtgctt
cttcaggccgtcccgcagtgggacgccggtggccacgcagctgacgaggaggcgtataac
tttatcaagcgccttgctcagattgtggtggccctggccacggaccaactctgccccttg
tggagccgtaacaatggcccttacaaacatgcaccaccaacctttgaaagttacttgagc
gctctaatcgcacttactcgacacccaagcgagttggtctgctctcttaccgtgccagct
tggatggccctgcttaatcacgacgacgcctgtcgggaaaaagtactacaggacgttcag
ccttatttgctccatgatgcatttctccgattgatgcggggtggtgggttggaggaagat
gactcaccaggctccgagtttgcccagcaagactttggggatcaagaagagtacaaggcc
ttctttggtcttttccgtggcaagctgctcgatgtggtgcgcgccattggccgaaaccag
ccagctgcatcgttggaatttgcattgaaccaactttccgtggtcatgtccacgccccca
gattcagtcgatggtcgcgtccttttcaattcatgggacggcattgcggtgttctgggat
gcgattgtcgctgtcgcctatccaaccatcaatggggagggtcgtcgtggaaggaatgag
gccttgattgagcagctgaaaaactgcctggccgcgctactggactggtcatgcgccaac
cccttgctcatggaggccgagttgacagtgcttggggctttgctgcccgtgctcgagcat
gcgccacaagccttgcggcttatgctggagaagctattcaatgccatggaatatcaagct
caagaggactacgttcgtctgaatgaagccgcgcttcaatcttccacccatactggtttg
actgacggtgccaaggttcgccgtaaggcgggccagattcttaaaagcttgtgccaacgc
ccgcctccgagcttcactgataccgtgcaaggcatcatcgggcgtgtgcaacagttgctt
agccaagtcgagattggcgagatgcaacgaaggcttctgatcgaagccttggttgtgagc
ttcaattcgctgggtgacgacgtgcaagagcaatcgctgttgggctttttccagcccatt
ctggctgaatggtgtcacgaggagaatacccgcatgctctcttctgtcaatgcgttgatt
ggagccggtggtctcaactccggtgaaagctacccgcaagcacaagctacgaggctacgc
ttgaccatgagcgtcaatgcgtttttgtcggccgttcgtgatacggctccccgcggctcg
gcgggtgtcgacgcttcgactgtagccggggcggtactgcatgggcgggccagtagcgca
ggcattggcgctgctcatggggatcttgcgactctcagtggcttacatggggacgcgact
ggtggcaacgggttgcaataccctgcgctgtctctgctccaccaaactttgcccaatgtg
ctgcgactctgcaacactcttcatcacctcgaagtagcgccggctgcaaacaacatgctg
tctgccgacccgtcgacactgcctccgggcatggctgtgctcttggacctacgtcggagc
gatgtgcatgcaattctcgcagcaagtttggactcagcgtcacgcgacatgaccgcacag
gagctttggatggaccgagcgcgcttgtggctcttcaacctgcgagaaagctgctatcgc
attctcgggtgtaccttccgatacggcgttttatatggtgctgacgatcaggcagtgttt
cagcaggcttgcgttgaggtcatcagcgggctgcgcaagcgtgatttacggttgttttgg
aagctgacggtctatcctttcttgcgctatctgccgcgcgacccaaccatcaaaggacac
gccgtgcagacagcggcagcaatcatcttgcaaacttgccatcgcctgtcggcttccatg
ctggcagctcagcagggcacaggcggtagcaccggccctcgtgagctgtcaagcgaggag
ctcacccccgaacagcgagagattcttgaagaaaaactagatgttgatctcatggaaacg
gttatcatcaccttggatcacttgacagccgatgtcaagctccaacgcgaggagaccatc
gaggacaagttttatcatcagccagagcttggtccctcagcctgggctattttggccgat
cacagctgtggtgaagctcttctggtgtttttatgccaatctctagccggtcgacatgcc
tcgcaggcaaataaggcctgtgccaccctcttgcgcttggtgcccgcgctggctagtcat
gacgtttacagccccggcctggctaccttggttccatcagccttacttgacgccttggct
gcgcacggcgaacaccacgacaacctgaccaaccttctccttcttgctggaaaatgcctg
ctatggctgggtgttcatccggcctgtcaatccactttcatgaccgtgcctgacatcaat
gctgaccatctgatggagacgtacaacatgcttcaaaaccgtgaactgcgcaacaccaag
ccgattcgcctacgcatgaagtccctcttggatggcacgatcggagtcaatgtggggcag
gtgtacaacgcccggcccaaggtattggatcttccacaaaagctggtgttggcgcgacaa
cccactgcagatgaggatgacgaccctgatcttcaaatctccgccctgtttgatgagtga

DBGET integrated database retrieval system