KEGG   Monosiga brevicollis: MONBRDRAFT_33326Help
Entry
MONBRDRAFT_33326  CDS       T01042                                 

Definition
(RefSeq) hypothetical protein
  KO
K14298  mRNA export factor
Organism
mbr  Monosiga brevicollis
Pathway
mbr03013  RNA transport
Brite
KEGG Orthology (KO) [BR:mbr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    MONBRDRAFT_33326
Messenger RNA biogenesis [BR:mbr03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     MONBRDRAFT_33326
Chromosome and associated proteins [BR:mbr03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    MONBRDRAFT_33326
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 DUF5046 VCBS
Motif
Other DBs
NCBI-GeneID: 5893022
NCBI-ProteinID: XP_001747677
JGI: 33326
UniProt: A9V4R5
AA seq 352 aa AA seqDB search
MFGAAAASRDVEVNPPPGDTPQCIKWSPVSNHLAVGSWDSTVKVYEISPQGQSAPRQEFK
FGAPVLDVDFVADGSKCVTAVADKTAQLCDLATGQTQQIAAHDAPVKSARFLPQLNAVMT
ASWDQTVKFWDMRSPNAVASFTLGGRCYSADAVNNLAAVVTSDRKVSVFTLDGGPRPFRE
IELRATTAQAGQSASQALLNLQPRVLRCFPSGDGFAVGSIEGRVAILYADPAKHEKEKFS
FKCHRTADKGSTDAYAVNDIAFHKQHGTFATVGGNGVFYFWDKVNRNKLKEFPKAKAEIT
CCDFNGDGTLFAYGCGYDWSKGHAHYNQAGYKGVLIHAVQSADISPRPVQRR
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgttcggtgctgccgctgcatcgcgtgacgtcgaggtcaacccgcctcccggtgacacg
ccgcaatgcatcaagtggtcacctgtcagcaatcatctggctgttgggagctgggactca
acggttaaggtttatgagattagcccccagggacaaagtgcgcctcgccaagaattcaag
tttggtgcacccgttcttgacgttgattttgtggcggatggttccaagtgcgtgactgcc
gtggctgataagacggcgcaactttgtgacctggccactggccaaactcagcagattgcc
gcgcatgatgcgccggtcaagtcggcacgatttttgccccaactgaatgccgtcatgaca
gcttcgtgggatcagacggtcaagttttgggacatgcgatcccccaatgctgtggcctcg
ttcacgttgggtggccgctgttactctgcagatgccgtcaacaaccttgcagccgtggtt
acctcagaccgcaaggtgtccgtcttcacgctcgatggtggcccacgtcctttccgcgag
attgagcttcgagccacaaccgcgcaggccggccagtctgcttcacaagctttgctcaac
ctccagccccgcgtactgcgctgcttcccgagtggcgatggatttgctgttggctcaatc
gaaggccgtgtcgccatcttgtatgccgacccagctaaacacgagaaggaaaagttttcg
ttcaagtgccatcgcacggcagacaagggctcaacggacgcctacgcggtcaatgatatt
gccttccacaagcagcacggaacttttgcaacggtcggcggcaatggtgtcttttacttc
tgggacaaagtcaaccgcaacaagctcaaggaattccccaaagccaaggccgaaatcacg
tgttgcgatttcaatggcgatggcacgctctttgcctacgggtgtggctatgactggtcc
aagggccacgcacattataatcaagccggctacaagggtgtcttgattcatgcagtgcag
tcagcagatatctcccctcgcccggtgcagcgccgttaa

DBGET integrated database retrieval system