KEGG   Monosiga brevicollis: MONBRDRAFT_33782Help
Entry
MONBRDRAFT_33782  CDS       T01042                                 

Definition
(RefSeq) hypothetical protein
  KO
K12319  guanylate cyclase soluble subunit beta [EC:4.6.1.2]
Organism
mbr  Monosiga brevicollis
Pathway
mbr00230  Purine metabolism
mbr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mbr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    MONBRDRAFT_33782
Enzymes [BR:mbr01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     MONBRDRAFT_33782
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc HNOBA HNOB EHD_N
Motif
Other DBs
NCBI-GeneID: 5893958
NCBI-ProteinID: XP_001748626
JGI: 33782
UniProt: A9V7H3
AA seq 742 aa AA seqDB search
MYGFLQSSLISLLKQYPDFEERMRQIKDSLGYEGNLDDFFLHYDDTTSFSFLGKVAESLG
MSQEECLSKSGELALDTFISNGYMPILQTMGHDFFTFINSLDAMHDNFLAAFPKMKMPSF
RPRRNDDGTMTIHYYSRRKFLAPYAMSMIKGVAKALFDLDIQIEHSIKKGYNRADHDEFL
ITAGPELFPPEAEEDAEDIASNTTVSMDSAAIDRLFPWHFAFDEELKIVSIGSQLRRHLN
ANPIGSKLADIMAIQRPLEAKYRYDDFQQRSGNPYQLALHRDAQADIQIASHYAATDDNS
DACSVAASELSNVGCPFSGGRRRSDESAISSIDRMQALRNMPQRIIQLHGEFVALQEGQL
FFAGAPLLRDVKQLDAQGITMSDLPVHSHASEILYASMFQAMSAKRANKADKELLMLNNN
RDEVRRQQEITANLLHSILPPRIADALTKGETPPAETFPATTILFSDIVGFTSISGSVPP
EEVMAMLNELFAKFDDLTRLHGVYKVETVGDAYVVSCGAPDPCDNHAERMCNFAIDMVRV
ASSVISPLDGEPLKIRCGLHSGTVMTGCVGNMECKPRYCLFGDTVNVASRMESTGLPASI
QISYRVIRALPDASQYNIITRGRIAIKGKGTMKTFLLLGHADSLDPPLYPKLSSNEREEE
VWNRNGNKEPVDDDSDSARGPSDAHPSVVDMARSLRVRSPSMMLSESNLRRMNQINMRES
ISVPKNRWPSPKVVADNFVIAE
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atgtacggtttcctgcagtcgtcgttgatctcactcctcaagcagtatcccgactttgag
gagcgcatgcgccagatcaaagacagcctgggctatgaaggcaacctcgatgactttttc
ctccactacgatgacaccacctccttttcctttcttggcaaagtcgctgagtcattgggc
atgtcccaggaagagtgtttgtccaagtcgggcgagctcgccctcgataccttcatctcc
aacggctacatgcccatccttcagaccatgggtcatgactttttcacttttatcaacagc
ctcgatgccatgcacgacaactttttggccgcctttcccaagatgaagatgccttctttc
cgaccccgtcgcaacgatgacggcacaatgaccattcactactattcccgccgcaaattt
cttgcgccctacgccatgagcatgatcaagggtgtggccaaggccctttttgacctcgac
atccagatcgagcacagcatcaaaaaggggtacaaccgtgccgatcacgatgagtttctc
attaccgccggcccggaactcttccccccagaggccgaggaagacgctgaggacattgcc
agcaacaccacggtctccatggatagtgctgccattgaccggctcttcccctggcatttt
gcctttgatgaggagctcaaaattgtgagcatcggctcccagcttcgccgccatctcaac
gccaaccccatcggctcaaagcttgctgacatcatggccatccagcgccccttggaggcc
aaataccgctacgacgactttcaacagcgatctggcaacccataccaattggccctgcat
cgcgacgctcaagctgacatccaaatcgcctcccactacgctgctacagatgacaacagc
gatgcctgcagcgtggcagccagtgagctctcaaatgtaggctgccctttcagtggtggc
cgccgacgcagcgatgagtctgccatcagctctattgatcgcatgcaagccctccgcaac
atgccccagcgcatcatccagctgcacggcgagtttgtggccctgcaagagggtcagctc
ttctttgcaggcgcgcctcttttgcgtgacgtcaagcaactcgatgcccaaggcatcacc
atgagtgacttgcccgtccacagccacgccagcgagatcctctacgcctcgatgtttcag
gccatgtccgccaagcgtgccaacaaggccgacaaggagcttctcatgctcaacaacaac
cgcgacgaagttcgccgccagcaggagattacggccaatctcctccacagcattcttcca
ccccgcattgccgatgctcttaccaagggtgagacaccgccggccgagacgttcccggcc
accaccatccttttcagcgacattgttggctttacaagcatctccggctctgtgccaccc
gaagaggtcatggccatgctcaatgagctctttgccaagttcgacgacttgactcgccta
cacggcgtgtacaaggttgagacggtgggggatgcctacgttgtcagctgtggtgcccca
gatccctgtgacaaccacgccgagcgcatgtgcaactttgccattgacatggtgcgcgtc
gccagctcggtgatctcgcccctcgacggcgaaccactcaagattcgatgtggtctgcac
agcggcaccgtcatgacgggctgcgtcggcaacatggagtgcaagcctcgctactgtctc
tttggagatacagtcaacgtggccagtcgcatggagtcgactggtctgcctgcttcgatc
caaatcagctaccgcgtcattcgtgcgctgcccgatgcatcccagtataacatcatcacc
cgtggtcgcatcgccatcaagggcaagggtaccatgaagacatttttgctcttgggccat
gctgactctcttgacccacctctttaccccaagctctccagcaacgagcgggaggaggaa
gtctggaaccgcaacggcaacaaggagccagtagatgatgacagcgactcagcccgtggt
cctagcgacgcccacccttcggttgtcgacatggcccggtctctacgcgtccgcagtcct
agcatgatgttgagcgagagcaacctgcgtcgcatgaatcaaatcaacatgcgtgagtct
atcagcgtacccaagaaccgttggccttctcccaaggtggttgctgacaactttgtgatt
gcagaataa

DBGET integrated database retrieval system