KEGG   Monosiga brevicollis: MONBRDRAFT_33796Help
Entry
MONBRDRAFT_33796  CDS       T01042                                 

Definition
(RefSeq) hypothetical protein
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
mbr  Monosiga brevicollis
Pathway
mbr00230  Purine metabolism
mbr01100  Metabolic pathways
Module
mbr_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:mbr00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    MONBRDRAFT_33796
Enzymes [BR:mbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     MONBRDRAFT_33796
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_33 AAA_16 AAA_22 MMR_HSR1 dNK RsgA_GTPase Rad17 ABC_tran RNA_helicase AAA_14 AAA_28 NACHT AAA_24 AAA_29 T2SSE PRK Dynamin_N Zeta_toxin AAA_17 AAA Pox_A32 Viral_helicase1 cobW DUF2075 ATPase_2
Motif
Other DBs
NCBI-GeneID: 5893882
NCBI-ProteinID: XP_001748709
JGI: 33796
UniProt: A9V7J9
AA seq 237 aa AA seqDB search
MRFLAGIFANPAAVMGIVTSCMSASVRTTTIMANPPAKKDQPRPIVVSGPSGAGKSTFLK
RLFKEFPDVFALSVSHTTRKPRTGEQDGVDYHFTEREVMEQMIASDEFVEHAQFGGNLYG
TSKRAISDVAAQNRICILDIERQGCENVRNLDMQPLFVFVQPPSVEVLEQRLRSRNTETE
ESLQKRLAEAESAMVYGATPGKFDHVIVNDDLDAAYEKFKACLMPDIEHAKKMQAAA
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgcgctttttggctggtatctttgccaacccggccgccgtcatgggcattgtcacctcg
tgcatgagcgccagcgtgcgcaccacgaccatcatggccaatcctcccgctaagaaggac
caaccccggcccatcgtcgtctctggcccttcgggtgctggcaagagcaccttccttaag
cgtctatttaaggaatttcccgacgtgttcgctcttagcgtctcccacaccacgcgcaag
cctcgcactggcgagcaggacggtgtcgactaccactttacggagcgggaggtgatggag
caaatgattgcctcggacgagtttgtggagcatgctcagtttggcggcaacctctatggc
accagcaagcgcgccatctcggatgtggcggctcagaaccgtatttgcattttggatatt
gaacgtcagggctgcgaaaacgtccgcaacctggacatgcaacccctctttgtgtttgtg
cagccacccagcgtggaggttctggaacagcgtctccgcagccgtaacacggaaaccgag
gaaagcctgcaaaagcgtctggccgaagccgaatccgccatggtttacggagctacgcct
ggcaagtttgatcacgtcattgtcaacgacgacctcgatgccgcctacgaaaagttcaag
gcttgtttgatgcctgacattgagcacgccaagaaaatgcaggccgcggcgtaa

DBGET integrated database retrieval system