KEGG   Monosiga brevicollis: MONBRDRAFT_34200Help
Entry
MONBRDRAFT_34200  CDS       T01042                                 

Definition
(RefSeq) hypothetical protein
  KO
K03144  transcription initiation factor TFIIH subunit 4
Organism
mbr  Monosiga brevicollis
Pathway
mbr03022  Basal transcription factors
mbr03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:mbr00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    MONBRDRAFT_34200
  Replication and repair
   03420 Nucleotide excision repair
    MONBRDRAFT_34200
Transcription machinery [BR:mbr03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     MONBRDRAFT_34200
DNA repair and recombination proteins [BR:mbr03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     MONBRDRAFT_34200
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tfb2 Helicase_C_3
Motif
Other DBs
NCBI-GeneID: 5894858
NCBI-ProteinID: XP_001749560
JGI: 34200
UniProt: A9VA65
AA seq 417 aa AA seqDB search
MMAHLLDELLLKQPEAFVELVYAEPAAVLSIYQRLSGPARHLLLRFLYQPDATLDKKQFA
AYFLKDEDAETVRIELTQRFLLKTMTDGMLTFGSVFLDSLRTALAGRTDAPDQAMPPPKK
ASEVTPAFLEEHSRVSWEAILSYMTTNAELKNSTMILILQEAQLIVNDQPPISVTPEGFQ
FLLQDRANQVWLLIVTFLKLLSREEPIPGEGLPMHEALVLLFRIGLGRLNEVSVLEFSAE
NLTTMQITFLRQLHYMGVVYHRNRKSKRFFLTPYAVMLYHNAELALSQTETGFLLAETNF
HVYAYTDSAVKVALLSKFATLTYRLPIMTTAIITRTSVRRALSQGITADQILRFMQRSSL
LLRHHDETAPTRPTSPQHATPYSCMLLSPPSFDFFKHGLIQIGACEPHDASQEQEPK
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgatggcgcacctcttggatgagctgcttttgaagcagccagaggcctttgtggagctc
gtgtatgccgagcctgcggccgtcctctccatctatcaacgcctctcgggcccggcccgg
catttactgttgcgctttctgtaccagcccgatgcaactctggacaagaagcagtttgca
gcctactttctcaaagacgaggacgccgaaactgtgcgcatcgagctcacgcagcgcttt
ctgttgaagaccatgacggatggcatgctcacctttggctctgtcttcctggattctctc
cgaactgcactggctggccgcacggacgccccagatcaggccatgccgccgccgaaaaag
gcctccgaagtcacgcctgcgtttttggaagaacattctcgtgtcagctgggaggccatc
ctcagctacatgacaaccaatgccgagctcaagaacagcaccatgattttgatattgcaa
gaggcgcagctcattgtcaacgatcagccacccatctctgtgacgccagaaggcttccag
tttcttttgcaggatcgagctaaccaagtgtggctgctcattgtcacttttctcaaactt
ctctcccgggaagagcccatacccggggagggcctgcccatgcacgaagcgcttgttctc
ctttttcgcattggcctgggccgtttaaacgaggtatccgtcttggaattctctgccgag
aatctgaccacgatgcagattacgtttctgcgccaacttcattacatgggtgtcgtctat
caccgcaaccgtaaatccaagcgtttctttttgaccccttatgctgtcatgctctaccac
aatgccgagctcgcgctctctcaaaccgagaccggctttctcttggctgaaacaaacttt
cacgtgtatgcctacacggacagcgcagtcaaagtggctctcctctccaagtttgcaacg
ctgacgtatcgtcttcccatcatgaccaccgccatcatcacccgtacttcggtgcgtcga
gccctaagccaaggcattactgccgatcaaatattgcgcttcatgcagagatcctcgttg
ttgctccgccaccatgacgagacagcacccactcgacccacctcgccacaacacgccacg
ccctattcgtgcatgcttctctctcctccctcttttgactttttcaaacatgggctaatc
caaataggtgcatgcgagccccatgatgcgagccaagaacaagaacccaaatga

DBGET integrated database retrieval system