KEGG   Monosiga brevicollis: MONBRDRAFT_34585Help
Entry
MONBRDRAFT_34585  CDS       T01042                                 

Definition
(RefSeq) hypothetical protein
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
mbr  Monosiga brevicollis
Pathway
mbr00052  Galactose metabolism
mbr00561  Glycerolipid metabolism
mbr00600  Sphingolipid metabolism
mbr00603  Glycosphingolipid biosynthesis - globo and isoglobo series
mbr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mbr00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    MONBRDRAFT_34585
  Lipid metabolism
   00561 Glycerolipid metabolism
    MONBRDRAFT_34585
   00600 Sphingolipid metabolism
    MONBRDRAFT_34585
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    MONBRDRAFT_34585
Enzymes [BR:mbr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     MONBRDRAFT_34585
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Melibiase_2 Melibiase Melibiase_2_C
Motif
Other DBs
NCBI-GeneID: 5895733
NCBI-ProteinID: XP_001750506
JGI: 34585
UniProt: A9VCP1
AA seq 403 aa AA seqDB search
MAVWQSQMTAGGLVVVLLLVTPAFSLDNGLGLTPPMGFNPWNCYGIESTGLPKLPGSKIV
GFNETVIKAVADAFVTLGLKEAGYEYVNLDCGYSTGFRDAQGQLVVNTSLYPSGLKALGD
YIHDKGLKFGLYSDAGAVQCCSRIWPGANDGSLGHEAADAAWFASLGIDYLKHDNCNPGP
SSYPDMRDALNKTGRPIYYSIHGPIANDSLANCWRTTTDINPNWDSFYQRAHENNQYIAA
ARPGAFNDADMLEVGNAPLTMAENRAHFSLWCLMKAPLLIGTDLVANPPSRSVLEILTNK
DAIAINQDPLGQQGRFQNATADGCEVWSGALADGDTAAIILNVQNSTVTCNAPLSMIPGL
NLTQDMSVRDIWSGQTVSLPAGSKTWKVTLDSHDVAFLRFTKA
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atggcagtgtggcagtcacagatgacagccggggggctggtggtggtgttgctactggtc
acgcctgcgttcagcctggataatggactcggattgaccccgcccatggggtttaatccc
tggaattgctacggcattgagtctaccggcctgcccaagctgccgggctcgaagatcgtg
ggctttaacgagacagtgatcaaggccgtggcggatgcttttgtcactttgggcctgaag
gaagctggctacgaatacgtcaaccttgactgtggctattccactggctttcgcgatgct
cagggccagctcgtagtcaacacttcactctatccctctggcctcaaggccctcggggac
tacatccatgataagggcctcaagtttggcctctacagtgacgctggcgccgttcagtgc
tgcagccgcatctggcctggcgctaatgatggatcgctgggccatgaagccgccgatgcc
gcctggtttgctagcttgggcattgactacctcaagcacgacaactgcaatccgggccct
tcctcgtatcctgacatgcgtgatgccctgaacaagacaggccgtcccatctactactcc
attcatggcccaattgccaatgattcgctcgccaactgctggcgcaccacgactgacatc
aaccccaactgggactctttttaccaacgcgcccatgagaacaaccagtacattgccgca
gcccgaccaggtgccttcaacgatgctgacatgctcgaggtgggcaacgcacccctgacc
atggctgaaaatcgggcacatttttccttgtggtgtctcatgaaggcgccacttctcatt
ggcactgatctggttgccaatcccccatcacgaagcgtgttggaaatcttgactaataaa
gatgccattgccatcaaccaagaccccctgggtcagcagggccggttccaaaacgccaca
gctgatggctgtgaggtgtggtctggggcgctagctgatggtgacacagcagccatcata
ctcaatgtgcaaaactccaccgtgacctgcaatgcccccctgagcatgatacccgggctc
aatctcacccaggacatgagcgtgcgcgacatttggagtggccaaacagtgtcattgcct
gctgggtccaagacgtggaaagtgacgctcgattctcatgatgtggcctttctgcgattt
accaaggcttga

DBGET integrated database retrieval system