KEGG   Monosiga brevicollis: MONBRDRAFT_38583
Entry
MONBRDRAFT_38583  CDS       T01042                                 

Definition
(RefSeq) hypothetical protein
  KO
K15013  long-chain-fatty-acid--CoA ligase ACSBG [EC:6.2.1.3]
Organism
mbr  Monosiga brevicollis
Pathway
mbr00061  Fatty acid biosynthesis
mbr00071  Fatty acid degradation
mbr01100  Metabolic pathways
mbr01212  Fatty acid metabolism
Module
mbr_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:mbr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    MONBRDRAFT_38583
   00071 Fatty acid degradation
    MONBRDRAFT_38583
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mbr01004]
    MONBRDRAFT_38583
Enzymes [BR:mbr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     MONBRDRAFT_38583
Lipid biosynthesis proteins [BR:mbr01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   MONBRDRAFT_38583
SSDB
Motif
Pfam: AMP-binding Cas_Cas2CT1978
Other DBs
NCBI-GeneID: 5894478
NCBI-ProteinID: XP_001749141
JGI: 38583
UniProt: A9V8W8
AA seq 653 aa
MESKQLPLGQHYGVDPDTVLDIKTTPDGIASIKPVTVMERFKETVERFGDRDALAVKRDG
YWHTWTYRDYHRDIITAAKAFIHFGLDRHHSVGIIGFNSPEWFIADLGAVFAGGFASGIY
TTNGPESLQYVADHSRSQFLFVEDRKQLAKIKEVQDQLPTVKLVVMWGEPVEEKDRKDLK
IKVIGWDEFMRGGRDVAEHEVHNRMKVQSPGECCTLIYTSGTTGTPKAVMMTHDNITWTA
KALSTHARLDDHRQEHIISYLPLSHIAAQILDMHAPILMGAKVWFAQPDALKGSLPTTLA
EVRPTIFLGVPRVWEKIEEKMRIVGAQSTGLKKKIATWAKRKGMEASMADQRGERRPSGF
GLANKLVFKKIRAKLGLDRCHFLATAAAPISRETLDYFLSLYLPIMEVYGMSENTGPQTV
NRSGNHTTGSVGVTMAGLETKIDNPDANGDGEICMRGRHVMKGYLFNEEKTRETIDEDGW
LHTGDVGRMDDRGFLFITGRIKEIIITAGGENVAPVPIEDTMKACCPILSNVMVIGDKRK
FLSQVVTLKCEVDVESGEPLDKLTDQVIEILSSIGSSATTVSAAREDPKVIEYIDAKRKE
ANNKSVSRAQNVQKSYILPVDFSVPGGELGPTLKLKRPVVYEKYKDVIDGLYA
NT seq 1962 nt   +upstreamnt  +downstreamnt
atggagtccaaacaattgcccttgggccaacactatggtgtggatcccgacaccgtgctt
gacatcaagaccacgcctgatggcatcgcgtcgatcaagcccgttacggtcatggaacgc
ttcaaagaaactgtcgaacgctttggcgatcgcgatgcgctcgctgtaaagcgcgatgga
tactggcacacctggacctaccgcgactaccaccgcgacattatcaccgccgccaaggcc
tttatccattttggccttgatcgccaccactctgttggtatcattggcttcaactcaccc
gagtggttcatcgccgatcttggtgccgtcttcgccggtggtttcgcctctggcatctac
accaccaatggacccgagagcctgcagtatgtggctgaccactcccgcagccagtttctc
tttgtggaagaccgcaagcagctcgccaagatcaaggaggttcaggatcaactgcccact
gtcaaattggtggtcatgtggggtgagcctgttgaggagaaggatcgcaaagacctcaag
atcaaggtcattggctgggacgagtttatgcgcggtggccgagatgtggcggagcacgaa
gtgcacaaccgcatgaaggtgcagtctccaggcgagtgctgcaccctcatctacaccagt
ggcaccacaggtacccccaaggccgtgatgatgacacacgacaacatcacttggactgcc
aaggcactctccacgcacgcccgtctggatgatcatcgtcaggagcacatcatctcctac
cttcccctctcccacattgccgcccaaatcctggacatgcatgcacccattctgatgggg
gccaaggtctggtttgctcaaccggacgccctcaagggcagcctgcccaccaccttggct
gaagtgcgccctaccatcttcctgggtgtcccacgtgtgtgggagaagattgaggaaaaa
atgcgcattgtgggtgcccagtccacgggcctcaagaagaagattgccacctgggccaag
cgcaaaggcatggaagcctccatggccgatcagcgcggcgaacgccgcccctctgggttt
ggcctcgccaacaaactggttttcaagaagattcgcgccaagttgggccttgaccgctgc
catttcctggccacggcagctgcacccatcagccgggagacgctcgactactttttgagc
ctgtacttgcccatcatggaagtgtacggcatgagcgagaacacgggcccgcaaaccgtc
aaccgcagcggcaatcacacgacaggctctgtgggtgtgacgatggccggccttgagacc
aagattgacaaccccgatgccaatggcgatggcgaaatctgcatgcgcggtcgtcacgtc
atgaagggctacctcttcaatgaggagaagactcgcgagaccattgatgaggatggctgg
ttgcacacgggcgatgtgggacgcatggatgaccgaggctttctcttcatcacaggccgc
atcaaggaaattatcatcacggccggcggtgagaacgtggcccccgtgcccatcgaggac
accatgaaggcgtgctgcccgatcctcagcaatgttatggtcattggtgacaagcgcaag
tttctgagccaagtcgtcacgctcaagtgcgaggtggacgtcgaatcgggtgagccgctg
gacaagctgacggatcaagtcatcgagattctgagctccattggcagcagcgccaccacg
gtgagcgccgcgcgcgaagaccccaaggtcatcgagtacattgatgccaagcgcaaggag
gccaacaacaagtctgtgtcgcgcgcccaaaacgtgcaaaagagctacatcctgcccgtg
gactttagcgtgcctggtggtgaactgggccctaccctcaagctcaagcggcctgtggtc
tacgaaaagtacaaagacgtcatcgatggcctctacgcataa

DBGET integrated database retrieval system