KEGG   Monosiga brevicollis: MONBRDRAFT_38883Help
Entry
MONBRDRAFT_38883  CDS       T01042                                 

Definition
(RefSeq) hypothetical protein
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mbr  Monosiga brevicollis
Pathway
mbr00040  Pentose and glucuronate interconversions
mbr00052  Galactose metabolism
mbr00500  Starch and sucrose metabolism
mbr00520  Amino sugar and nucleotide sugar metabolism
mbr01100  Metabolic pathways
mbr01130  Biosynthesis of antibiotics
Module
mbr_M00361  Nucleotide sugar biosynthesis, eukaryotes
mbr_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mbr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MONBRDRAFT_38883
   00052 Galactose metabolism
    MONBRDRAFT_38883
   00500 Starch and sucrose metabolism
    MONBRDRAFT_38883
   00520 Amino sugar and nucleotide sugar metabolism
    MONBRDRAFT_38883
Enzymes [BR:mbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     MONBRDRAFT_38883
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGP DUF1647
Motif
Other DBs
NCBI-GeneID: 5895088
NCBI-ProteinID: XP_001749784
JGI: 38883
UniProt: A9VAS8
AA seq 497 aa AA seqDB search
MALKRSESLNSVTSYSHEQGDAALTLSAELSKLIMTAPLNLRDEVERNCKGFQTLFDQYM
GERGTKISWDKIRPPPAGSIVPHATVAAGEPKAASELSVPLSKLAVLKLNGGLGTSMGCV
GPKSVISVRNDLTFLDLCVRQIEHLNDSYGTTVPLVLMNSFNTHDDTQKVLRKYKKTEVK
VFNQSQYPRILKETLQPLPKNTDNSDEDWYPPGHGDLYRSFYDSGLLQELLDDGKEWVFI
SNIDNLGATVDEDILRYVTRPGNDCEFVMEVTDKTRADVKGGTLIEYEGRIRLLEVAQVP
KDHEEDFKSVTKFRVFNTNNLWINLHAIKRLVEEESLHMEVIENKKTLDDGRVIIQLEQA
VGSAIKNFNGAIGINVPRSRFLPVKKTSDLLLVMSNLYQLRHGTLSMNASRLFDSVPLIK
LGDHFKKVKDFLRRFENIPDILELDHLTVSGDVKFGKNVILRGTVIIIAQENDSIDIPQG
SVLENKIVTGNLRILDH
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggcgttgaagcgttcggaatctctcaacagcgtgacctcgtactcgcacgagcaaggc
gatgcagcgctcaccctctcggcggagctctccaagctcatcatgaccgctcccctcaac
ctccgcgacgaggtcgagcgcaactgcaagggcttccaaaccctctttgatcagtacatg
ggcgagcgcggcaccaagatcagctgggacaagatccgcccgccgccggctggctctatt
gtgccacatgcaacagtggctgccggggaacccaaggcggccagtgaactgagcgtgcct
ttgtccaagctggccgttctcaagctcaacggtggtctcggcacctccatgggctgtgtt
ggccccaagagcgtcatctcggtccgcaacgatctcacctttctggacctttgcgttcgc
cagatcgagcatctcaacgacagctacggcaccaccgtgcccttggtgctgatgaactcc
ttcaacacccacgatgatacccaaaaggttcttcgcaagtacaaaaagaccgaggtcaag
gtcttcaaccaaagccagtacccccgtatcctcaaggaaaccctgcagcccctccccaag
aacacggacaacagcgatgaggactggtatcccccaggccacggcgatctgtaccgttca
ttctacgactctggtctgctccaggagctgctggatgacggcaaggaatgggtcttcatc
agcaacattgacaaccttggcgccacagtggatgaggatattctccgctacgttacccgc
cctggcaacgactgcgagtttgtcatggaagtcacagacaagacacgcgctgatgtcaag
ggtggtaccctcattgagtacgagggccgcattcgcctcctcgaggtggcacaggtgccc
aaggatcacgaagaggacttcaagtcggtcaccaagttccgcgtgttcaacaccaacaac
ctctggatcaacctgcacgccatcaagcgcctcgtggaagaggagtccctgcacatggag
gtcattgagaacaaaaagacgctcgatgacggccgtgtcatcattcaactggagcaagcc
gtcggttcggccatcaagaacttcaacggtgccattggcatcaacgtgcctcgcagccgc
tttttgcccgtgaaaaagacctccgacctgctcctcgtcatgagcaatctctaccagctg
cgccacggcaccttgtccatgaacgcttcgcgcctgtttgactcggtgcctctgatcaag
ctgggtgaccacttcaaaaaggtcaaggattttttgcgtcgctttgagaacattcccgac
attctggagctggatcacttgaccgtgagcggtgacgtcaaatttggcaagaatgtgatc
ctgcggggcactgtcattatcattgcgcaggagaacgactcgatcgacattccccagggc
tccgttctcgaaaacaagattgtgactggcaacctccgaatcctcgaccattag

DBGET integrated database retrieval system