KEGG   Monosiga brevicollis: MONBRDRAFT_39088Help
Entry
MONBRDRAFT_39088  CDS       T01042                                 

Definition
(RefSeq) hypothetical protein
  KO
K00856  adenosine kinase [EC:2.7.1.20]
Organism
mbr  Monosiga brevicollis
Pathway
mbr00230  Purine metabolism
mbr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mbr00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    MONBRDRAFT_39088
Enzymes [BR:mbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.20  adenosine kinase
     MONBRDRAFT_39088
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PfkB
Motif
Other DBs
NCBI-GeneID: 5895559
NCBI-ProteinID: XP_001750260
JGI: 39088
UniProt: A9VC48
AA seq 341 aa AA seqDB search
MALSKGVLLGMGNPLLDISAHVDEAMLAKYDLKSNLAILAEEKHLPIYQELVDNYAVEYI
AGGATQNSIRVAQWMLKEPKTTAFIGCVGKDDYAKQLETAAGGCHVDVNYMYDESATTGT
CAVLVTGNERTLVANIAAANNYKAEHLEEKHIQELIDNARFFYISGFFLTVSPPSILRVA
KHACEKEKIFSMNLAAPFINQFFKEPLLQALPYCDFVFGNESEAAAFAEANDLGTTDVKE
IALKIAGLPKEGKRARVAVITQGPHPTIIATEGKITEYGVDAVTADKIVDTNGAGDAFVG
GFLSQLVQDKPIDECVRAGHWAAQLIIQRSGCTYPATCDFQ
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggctcttagcaagggagttttgctgggtatgggcaacccgctcttggacatttccgcc
cacgtcgacgaggccatgctggcaaaatacgatcttaagtccaatcttgccattttggct
gaggagaagcatctgcccatctaccaggagctcgtggacaactacgccgtggagtacatc
gctggcggcgccactcagaactcgatccgcgtcgcccagtggatgctgaaggagcccaag
accaccgccttcatcggctgcgttggcaaggatgattatgccaagcagctcgagactgcc
gccggcgggtgccacgtcgacgtcaactacatgtacgatgaatctgccactacaggcact
tgcgccgtgcttgttactggcaacgagcgtactctggtggccaacatcgctgcagccaac
aactacaaggctgagcacttggaggagaagcacattcaagagttgatcgacaatgcccga
tttttctacatttctggctttttcttgaccgtctcgccgccctccatccttcgcgtggcc
aagcacgcttgcgagaaggagaagattttctccatgaacctggctgctcctttcatcaac
caattcttcaaggagcctcttctccaggccctgccttactgtgattttgttttcggtaac
gagtctgaggccgccgcctttgctgaggccaatgatctgggcaccacggacgtcaaggag
attgctctcaagatcgctggtcttcccaaggagggcaagcgcgctcgtgttgccgtcatc
actcagggaccgcacccgactatcattgcaactgagggcaagatcaccgagtatggcgtg
gacgctgtgacggcggacaagattgtggataccaacggtgctggcgatgcgtttgtcggt
ggctttcttagccagcttgttcaggacaagcccattgatgagtgcgtgcgtgcgggtcac
tgggcggcgcagctgatcattcagcgctcaggctgcacctaccccgcgacgtgtgacttc
caataa

DBGET integrated database retrieval system