KEGG   Monosiga brevicollis: MONBRDRAFT_6362Help
Entry
MONBRDRAFT_6362   CDS       T01042                                 

Definition
(RefSeq) hypothetical protein
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
mbr  Monosiga brevicollis
Pathway
mbr00052  Galactose metabolism
mbr00500  Starch and sucrose metabolism
mbr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mbr00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    MONBRDRAFT_6362
   00500 Starch and sucrose metabolism
    MONBRDRAFT_6362
Enzymes [BR:mbr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     MONBRDRAFT_6362
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N PAN_4
Motif
Other DBs
NCBI-GeneID: 5889044
NCBI-ProteinID: XP_001743691
JGI: 6362
UniProt: A9UTM0
AA seq 456 aa AA seqDB search
MLRVQLLWACALLALLAGAVADRHRPVFHMVTDDWMNDPNDAVSDDLVYWKMLPMALDTD
EWYDQGGVFSGSATIMDDPARTPVLAYSVSTNDMQCLAFPANRSDPELIKWTKYSGNPVI
DSRNSTAPDGRDDTTAWRSADGKFWRMVYGTTSGAIIFSSTDFINWEQNHYMNSDDNSEQ
WECPDFFAVPNKGSDVYCLKASTKGRDYWVLGTYDDANNMTFVRQTPDMGNDTMLYDYGR
FYASKRFYDPVNERQILFGWVAEERTVDAHGAPYGLFHNCGPHVRRDELIFSPRDEMAHT
CSAYGQPTGWASIQSAPRTIGLTQDRTRLTYEPIEELKARLIAEFPCLTALMDKSRRWLA
SATVMKALDLILKKWICLVVTTSMSNVAMFVAKLSNQFSYWSTLSAVCSVTNVNYTDPHE
CEQVCDADEQCMAWTYVVRPPLHGRLSPLRSASLPL
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgagttcaactcttgtgggcatgcgcccttctcgcgctgctggctggagccgta
gcagatcggcatcgacctgtttttcacatggtcacggatgactggatgaacgatcccaac
gatgctgtttcggatgacctggtctactggaagatgctgcccatggcccttgacacggat
gaatggtatgatcaagggggtgtcttttctggctcagccaccattatggacgatcccgcg
cgcacccctgttctggcctactctgtgtccaccaatgacatgcaatgtctggccttccct
gccaatcgttctgatcctgaactcatcaagtggaccaagtactcgggcaaccccgtcatt
gacagtcgcaactcgaccgcacccgatggtcgcgatgacacgacggcctggcgcagtgct
gacggcaagttctggcgcatggtatatggcactacgagcggtgccatcatctttagcagc
acagactttatcaactgggagcaaaaccactacatgaacagcgatgacaacagcgagcaa
tgggagtgtccagacttttttgcggtgccgaacaaaggctcggatgtgtactgcctcaag
gcctcaaccaaggggcgagactattgggttctcggcacctacgatgacgccaacaacatg
acgtttgtacgccaaacgcctgacatgggcaatgacaccatgctctatgattacggtcgc
ttttatgcctcaaagcgcttctatgacccagttaacgagcgtcaaattctctttggctgg
gtggctgaggagcgaaccgtcgacgcgcacggtgccccatatggtctgtttcacaattgt
ggtccacatgtccgtagggatgaactcattttttccccccgagatgagatggctcacacg
tgttcggcttatggccaacccacaggatgggcctccattcagtcggcaccacgaaccatt
ggtttgacgcaggatcgcacacgactcacttacgagcccattgaagagctcaaggctcga
ctgattgcggagtttccgtgcttgacagccttgatggacaagagcagacgctggttggcg
tcggctacggtcatgaaagcgttggaccttatactgaaaaaatggatttgcctggtggtg
actacaagtatgagtaacgttgccatgtttgtggccaagctctcgaaccagttctcatat
tggtctacactttcggccgtttgcagcgtgaccaacgtcaactataccgatccgcacgag
tgcgaacaagtctgtgatgccgatgagcagtgcatggcctggacctacgttgtccgaccc
cctcttcatggtcggttgtccccgctgcgttccgccagcttacctttgtga

DBGET integrated database retrieval system