KEGG   Monosiga brevicollis: MONBRDRAFT_6817Help
Entry
MONBRDRAFT_6817   CDS       T01042                                 

Definition
(RefSeq) hypothetical protein
  KO
K12655  OTU domain-containing protein 5 [EC:3.4.19.12]
Organism
mbr  Monosiga brevicollis
Brite
Enzymes [BR:mbr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     MONBRDRAFT_6817
Peptidases [BR:mbr01002]
 Cysteine Peptidases
  Family C85
   MONBRDRAFT_6817
Ubiquitin system [BR:mbr04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   OTU
    MONBRDRAFT_6817
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OTU Peptidase_C65
Motif
Other DBs
NCBI-GeneID: 5889610
NCBI-ProteinID: XP_001744365
JGI: 6817
UniProt: A9UUC0
AA seq 318 aa AA seqDB search
MSPPPRRTNRRWLSCDSDEEDDEPGARTATVVRQRQRQELDTARVQAQRHQSLQRRAWEG
QHLSGDYDHKENDTQLRSRGRMGAAPRPSFEYDLQTQELSANNAVAANLSRRRPQDCPPA
TQRARLSHDPHEGLVGRAASTTHAAVAAASETGRRIQTDVAFASALRAEYGWEIVPMVGD
GACLFRAVETSSFTGLLRVSCIWNHQRRNRDHFQAFVTTDFDAYLEHKARPTTHGNHVEI
QAMSEIYNRRIEVYSYDTHPINIFQGSSHSEAPIRLSYHGQVHYNAINDPQHPSFGIGLG
LPGLRTLVSTTQNAGSIC
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgagccctcctccgcgaagaacgaatcggcgctggctttcttgtgacagtgatgaagag
gacgatgagcctggcgctcggaccgcaactgttgtacgacagcgacagcgacaagagctc
gacacagctcgagtgcaggcgcagcgccaccaatcgctccaacgtcgcgcctgggaaggg
caacatctttccggcgactacgaccacaaagagaacgacacacagctgcggtctcgaggc
cgcatgggagcagctcccaggcccagctttgaatacgacttgcaaacccaggagctgtca
gccaacaacgctgtggcagccaatctatctcgccgtcgaccgcaagactgcccccctgca
actcaacgtgctcgtttgtctcatgacccccatgagggcctggttggccgcgctgcctcg
accacccatgccgcagtcgctgccgcatctgaaacgggacggcgaattcagacggatgtt
gcgtttgcttcggcgctccgcgcagaatatggctgggaaatagtgcccatggtgggcgat
ggagcctgcttgtttcgcgctgtggagacctcttcattcaccggactgttgcgtgtttcc
tgcatctggaatcatcagcggcgcaatcgcgaccactttcaggcattcgtgaccacagat
ttcgatgcctacctcgagcacaaggctcgaccaaccacacatggtaatcacgttgaaatc
caagccatgtctgagatctacaatcgccgcatcgaagtgtactcctatgatacgcatccc
atcaacatttttcaaggcagcagccacagcgaggcacccattcgcttaagctaccatggt
caagttcactacaatgccatcaatgacccgcagcatcccagctttggcatcggcttgggc
ctgcccggactgcgcacgctggtgagtacaacccaaaacgcaggcagcatatgctga

DBGET integrated database retrieval system