KEGG   Methylocystis bryophila: B1812_02835Help
Entry
B1812_02835       CDS       T04837                                 

Definition
(GenBank) oxygen-independent coproporphyrinogen III oxidase
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
mbry  Methylocystis bryophila
Pathway
mbry00860  Porphyrin and chlorophyll metabolism
mbry01100  Metabolic pathways
mbry01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mbry00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    B1812_02835
Enzymes [BR:mbry01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     B1812_02835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C DUF2064
Motif
Other DBs
NCBI-ProteinID: ARN80195
UniProt: A0A1W6MRJ8
Position
634708..636054
Genome map
AA seq 448 aa AA seqDB search
MNAASLALAERSAPRYTSYPTSPHFSREIGDETIRAWLSALDANATLSLYFHVPFCREIC
AFCGCHTKALRQDAPLTSYKETLLREIELVAGATRARRVVSIHWGGGTPGILGASRFHEI
SETIARHFSIGSETEHSIELDPRVLTQEFVEALARSGVNRASLGVQDLNRHVQEASGRVQ
PYELVAQSVEWLRGAGIEAINIDLMYGLPHQSVEDVRRTATLAAGLNPSRLAVFGYAHVP
WFKTHQKLIDAAALAGAAERLAQADAVRETLEDAGFVAIGLDHFARPQDTLTQCWRAGTL
HRNFQGYTVDPADAMLPFGVSSIGKLPQGYIGNAADLAGWRRAIEADRFSTNRGLAFSPE
DIARGAVIEKLMCRFEVDYGAEATAHGFAEDAFDDALPRLQTFFDQGLATLEGRRLTMTP
PGRHFVRLAATAFDAYLDRGAARHSAAV
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccgcctcactcgccctcgccgagcgctccgcgccccgctacacaagctacccc
acctccccgcacttctcgcgcgagatcggcgacgagacgatccgcgcctggctctcggcg
cttgacgcgaatgcgacgctctcgctttacttccacgtccccttttgtcgcgaaatctgc
gccttctgcggctgccacacgaaggcgctgcgccaggacgcgccgctcacgagctataaa
gagactcttctgcgcgagatcgagctcgtcgcgggcgcaacaagagcgcggcgcgtcgtc
tccattcattggggcggcggcacgcccggcatcctcggcgcttcgcgtttccacgagatc
tccgagaccatcgcgcgtcacttctccatcggatccgagaccgagcattcgatcgagctc
gatccgcgcgtgctgacccaagagttcgtcgaggcgctggcgcgctccggcgtcaaccgg
gcaagcctcggcgttcaagacctcaaccggcatgtgcaggaagcctcgggccgcgtgcag
ccctatgagcttgtcgcgcaatcggtcgaatggcttcgcggcgccgggatcgaagcgatc
aacatcgatctgatgtatggcctgccgcatcagagcgtcgaggatgtgcgtcgaacggcg
acgctcgcggccgggctcaatccttcgcgtctcgccgtgttcggctatgcgcatgtgccc
tggttcaagacgcatcaaaagctcatcgacgccgccgcgctcgccggcgcggcggagcgg
ctcgcccaggccgacgcggtgcgcgagacgctggaagacgcgggcttcgtcgccatcggc
ctcgaccatttcgcgcgaccgcaagacacgctgacgcaatgctggcgcgcgggaacgctg
catcgcaatttccagggctatacggtcgaccccgccgatgcgatgctgcccttcggcgtc
tcgtcgatcggcaagctgccgcagggttacatcggcaacgccgccgacctcgcgggctgg
cggcgcgcaatcgaggccgatcgtttctcgacgaaccgcggcctcgccttctcgcccgag
gacattgcgcgcggcgccgtgatcgagaagctgatgtgccggttcgaggtcgactatggc
gcggaagcgacggcccacggcttcgccgaggatgcgttcgacgatgcattaccgcggctg
caaaccttcttcgaccagggcctcgccacgcttgaaggccgccgcctcacgatgacgccg
ccgggacgtcatttcgtgcgcctcgcggcgacggccttcgacgcctatctcgacaggggc
gcggcaaggcattccgcggcggtgtaa

DBGET integrated database retrieval system