KEGG   Methylocystis bryophila: B1812_11015Help
Entry
B1812_11015       CDS       T04837                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
mbry  Methylocystis bryophila
Brite
KEGG Orthology (KO) [BR:mbry00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    B1812_11015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: ARN81515
UniProt: A0A1W6MVA6
Position
2348785..2349177
Genome map
AA seq 130 aa AA seqDB search
MYVAITHDIQVTAIPDFLLDRSDPAQDRYFWTYTIEIANLGRRRVQLLTRHWVIIDAFGR
KEEVRGPGVIGEQPVLEPGETYRYHSFCPLTTPSGLMKGSYRMVDDAGESFDVEVPAFSL
DSPLSKPTLN
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgtatgtcgcgatcacccatgacatccaggtcactgcaatcccggacttcctgttggat
cgctcggaccccgcgcaagaccgctacttctggacctatacgatcgagatcgccaatctg
gggcgacgccgcgtgcagctcctgacgcgccactgggtcattatcgacgccttcggccgc
aaggaggaggtgcgggggccgggagtcatcggcgagcagccggtgctggagccaggcgaa
acctatcgctatcattccttctgccctctcacgacgccctcgggcctcatgaaaggcagc
tatcgcatggtcgacgacgcgggcgagagctttgacgtcgaggtgccggctttctcgctc
gacagcccgctgtcgaagccgacgctcaactag

DBGET integrated database retrieval system