KEGG   Methylocystis bryophila: B1812_13620Help
Entry
B1812_13620       CDS       T04837                                 

Definition
(GenBank) 4a-hydroxytetrahydrobiopterin dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
mbry  Methylocystis bryophila
Pathway
mbry00790  Folate biosynthesis
mbry01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mbry00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    B1812_13620
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mbry04147]
    B1812_13620
Enzymes [BR:mbry01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     B1812_13620
Exosome [BR:mbry04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   B1812_13620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: ARN81948
UniProt: A0A1W6MWH2
Position
complement(2869400..2869768)
Genome map
AA seq 122 aa AA seqDB search
MTTKDRVYSEAEIAEKLAKELPEWRYEGGWIRRTYKTHTWPGTLLLINTIGMLSEAAWHH
PDLVVSYAFVEVKLATHSAKGITDKDFELAKKLEETLLWRGQNAPEAPLAKRVLRGPKEA
HE
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgaaggatcgcgtctactccgaggcggagattgccgagaagctcgccaaggag
ctgcccgaatggcgctacgaaggcggctggatccgccgcacctacaagacgcacacatgg
cccggcaccctcctgctcatcaatacgatcggcatgctctcggaggcggcctggcatcac
cccgatctcgtcgtctcctacgccttcgtcgaggtgaagctcgccacccactccgccaag
gggatcaccgacaaggacttcgagctggcgaagaagctcgaggagacgttgttgtggcgc
gggcagaacgcgcccgaggcgccgctcgccaagcgcgtgctgcgggggccgaaagaggcg
catgagtga

DBGET integrated database retrieval system