KEGG   Methylocystis bryophila: B1812_16215Help
Entry
B1812_16215       CDS       T04837                                 

Definition
(GenBank) glutamate-1-semialdehyde 2,1-aminomutase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
mbry  Methylocystis bryophila
Pathway
mbry00860  Porphyrin and chlorophyll metabolism
mbry01100  Metabolic pathways
mbry01110  Biosynthesis of secondary metabolites
mbry01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mbry00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    B1812_16215
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mbry01007]
    B1812_16215
Enzymes [BR:mbry01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     B1812_16215
Amino acid related enzymes [BR:mbry01007]
 Aminotransferase (transaminase)
  Class III
   B1812_16215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: ARN82372
UniProt: A0A1W6MXR6
Position
3389913..3391598
Genome map
AA seq 561 aa AA seqDB search
MTVTIQTLLLTGLGGGALAALFPRLKRRLELSRAKHRSLAGHPRIARRLASFLPFYQYDE
TRFFCCDDASPEVAAQRRAGFMRLAEVYRERFAATSRLGAEAAQSISDMQFTERYRTPFQ
FSGYVARHLPSGAFLSASSGVTLTDLDGNVFHDLAASYGVNVFGNDFYKETIAEGAADAR
ALGPVLGAYHTAIVDNVRMLREISGLDEISFHMSGTEAVMQAVRLARYHTRRSHLLRFCG
AYHGWWGDVQPGIGNPAPAHETYTLSEMSPATLHVLRTRNDIACVLVNPLQALAPNAPAP
ADSSLVDSARSAHFDKAAYTQWLKELRAICSERGIVLIFDEVLVGFRLARGGAQEYFGVK
ADLVTYGKTLGGGFPVGVLCGRKDLMRRFREDRPGDICFARGTFNSHPYVICAMRRFLQR
LEEPSRRDLYRDLDSIWDERARRLNARFETEALPVRVANMSTIWMVSYTEPSRYNWMLQY
YLRAEGLALPWTGTGRLIFSLNYKEEDFAVVADRFIAAAKAMRDDGWWRAPAGLTNKTIR
RGVLKEMILHRLFGERAAISP
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgacagtcacgatccaaacgcttcttctcaccgggcttggcggcggcgcgctcgcggcc
ctcttccccaggctcaaacgccggctcgagctctcccgggctaagcaccgctcgctcgcc
ggacatccgcgcatcgcgcgaaggctcgcgtccttccttccgttctatcaatatgacgaa
acgcgctttttctgctgcgacgacgcctctcccgaggtcgctgcgcagcgccgagccggc
ttcatgcgcctcgccgaagtctatcgcgagcgatttgccgcgacgagccgtcttggcgcc
gaagccgcccagagcatctcggacatgcaatttaccgagcgctatcgcacgccttttcag
ttcagcggctatgtcgcgcggcatttgccgtcgggcgctttcctctcggcctcgtccggc
gtcacgctgaccgatctggacgggaatgtttttcacgatctcgcggcctcctacggcgtg
aatgtctttggcaatgacttctataaggagacgatcgcggaaggcgccgcggacgcgcga
gcgctcgggccggtgcttggcgcctatcacacggcgatcgtcgacaatgtgcgcatgctg
agggagatatcgggcctcgacgagatctccttccacatgtcgggcacggaagcggtgatg
caggcggttcgcctcgcgcgctatcatacgcgccgctcgcatctcttgcgcttctgcggc
gcctatcacggctggtggggcgacgtgcagccgggaatcggcaatccggctcccgcgcat
gaaacctatacgttgagcgaaatgtcgccagcgacactgcatgtcctgcgcacccgcaac
gacatcgcctgcgttctcgtcaatccattgcaggcgctcgcgcccaatgcgccggcgccc
gccgactcctcgcttgtcgacagcgcgcgctctgcgcatttcgacaaggccgcctatacg
cagtggctcaaggagctgcgcgcgatttgctcggagcgaggcatcgtgctgatcttcgac
gaagtgctcgtcggctttcgcctggcgcgcggcggcgcgcaggagtatttcggcgtcaag
gcggatctcgtcacttacggcaagacgctcggcggcggtttcccggtgggcgtgctttgc
ggccgcaaagatctcatgcggcgcttccgcgaggatcgtccaggcgacatttgcttcgcc
cgcggcacgttcaattcgcacccctatgtaatttgcgcgatgcggcgcttcctgcagcgc
cttgaagagcctagccgccgtgatctttatcgcgatctcgattcaatttgggacgagcgc
gcgcggaggctcaacgcgcgcttcgagacggaggccttgcccgtgcgggtcgcaaatatg
tcgaccatctggatggtcagctacaccgagccctcacgctataactggatgctgcaatat
tacctgcgcgccgaggggctcgctctgccctggacagggacgggacggctgatcttcagc
ctcaattacaaggaggaggatttcgccgtcgtggcggatcggttcattgcggcggcgaag
gccatgcgcgacgacggctggtggcgcgcccccgccgggctgacgaacaagacgatccgc
cgcggcgttctgaaggaaatgatcctccatcggctcttcggcgagcgcgcggcgatctct
ccctga

DBGET integrated database retrieval system