KEGG   Methylocystis bryophila: B1812_16415Help
Entry
B1812_16415       CDS       T04837                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mbry  Methylocystis bryophila
Pathway
mbry00071  Fatty acid degradation
mbry00072  Synthesis and degradation of ketone bodies
mbry00280  Valine, leucine and isoleucine degradation
mbry00310  Lysine degradation
mbry00362  Benzoate degradation
mbry00380  Tryptophan metabolism
mbry00620  Pyruvate metabolism
mbry00630  Glyoxylate and dicarboxylate metabolism
mbry00640  Propanoate metabolism
mbry00650  Butanoate metabolism
mbry00900  Terpenoid backbone biosynthesis
mbry01100  Metabolic pathways
mbry01110  Biosynthesis of secondary metabolites
mbry01120  Microbial metabolism in diverse environments
mbry01130  Biosynthesis of antibiotics
mbry01200  Carbon metabolism
mbry01212  Fatty acid metabolism
mbry02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mbry00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    B1812_16415
   00630 Glyoxylate and dicarboxylate metabolism
    B1812_16415
   00640 Propanoate metabolism
    B1812_16415
   00650 Butanoate metabolism
    B1812_16415
  09103 Lipid metabolism
   00071 Fatty acid degradation
    B1812_16415
   00072 Synthesis and degradation of ketone bodies
    B1812_16415
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    B1812_16415
   00310 Lysine degradation
    B1812_16415
   00380 Tryptophan metabolism
    B1812_16415
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    B1812_16415
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    B1812_16415
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    B1812_16415
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mbry04147]
    B1812_16415
Enzymes [BR:mbry01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     B1812_16415
Exosome [BR:mbry04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   B1812_16415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ARN82404
UniProt: A0A1W6MXV1
Position
3432768..3433958
Genome map
AA seq 396 aa AA seqDB search
MSSSGSVVIVGAARTPIGAFLGELKEATAPELGACAIAGALIRSKIPAERIDEVCMGCVL
TAGLGQAPARQAALEAGLPDSTGCVTVNKMCGSGMKAIMLAHDALSAGSAGAIVAGGMES
MSNAPYLLARARAGYRMGHGKILDHMFLDGLEDAYEKGRLMGSFAEDCARAYQFTRREQD
EYAIASLMRAQQAATEGAFDSQIVPMRIAGRKETRTIDVDETPRKANLEEIPRLKPAFAP
DGSITAANASSISDGAAALVLTTEAAARSGGLIPLATVVGHATHAAAPRDFPTAPIGAIE
KLLSRIGWTRDEVDLFEINEAFAVVVMAAMHDLGLSHAKVNVHGGACALGHPIGASGARI
VVTLLYALERYGLRRGVAALCIGGGEATALAIERVS
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgagctcgtccggatccgtggtcatcgtcggcgcggcgcgtacgcccatcggcgccttt
ctgggcgagttgaaggaggcgacggcgccggagctcggcgcatgcgcaatcgcgggagcc
ttgatccgctccaaaattcccgccgaacgcatcgacgaggtctgcatgggctgcgtgctc
accgctggcctcggccaagctccggctcggcaagcagcgctcgaggcgggcctcccggac
tcgacgggatgcgtcaccgtcaacaaaatgtgcggatcgggcatgaaggccatcatgctg
gcgcacgacgcgctcagcgccggaagcgcaggcgcgatcgtcgccggcggcatggagagc
atgagcaacgcgccctatctccttgcgcgcgcccgggcgggttatcgaatggggcacggc
aagatcctcgatcacatgtttctcgacgggctcgaggacgcttatgagaaagggcgtctg
atgggctccttcgccgaggactgcgccagggcctaccagttcacgcgccgggagcaggac
gaatatgcgatcgcttccctcatgcgcgcgcaacaggcggcgacggagggagctttcgac
tcccaaatcgtcccgatgcggatcgcgggtcggaaggaaacgcggacgatcgacgtcgac
gaaacgccgcgaaaggcgaacctggaagaaatacctagattgaaaccggcctttgccccc
gacgggtcgatcaccgcggcgaatgcgagctcaatttcggacggggcggccgccctcgtc
ctcacgaccgaggcggctgcgcgatccggcggtctcatccctctcgccaccgtcgtcggc
cacgccacgcacgccgcggcgccacgcgattttccgacggcgccgatcggcgcgatcgag
aagctgctttcgcgcatcggctggacgcgcgacgaggtggatctcttcgagatcaacgag
gcgttcgccgtcgtcgtcatggccgccatgcacgatctcggactttcgcacgccaaggtc
aatgtgcatggcggcgcctgcgcgcttggccatcccatcggcgcttccggcgcgcgcatc
gtcgtcacgctgctttatgcgttggaaagatacggcttgcgccgcggcgtcgccgctctt
tgcatcggcggcggagaggccaccgcgttggcgatcgagcgcgtgagttga

DBGET integrated database retrieval system