KEGG   Methylocystis bryophila: B1812_17210Help
Entry
B1812_17210       CDS       T04837                                 

Definition
(GenBank) AraC family transcriptional regulator
  KO
K18199  cyclohexyl-isocyanide hydratase [EC:4.2.1.103]
Organism
mbry  Methylocystis bryophila
Pathway
mbry00930  Caprolactam degradation
Brite
KEGG Orthology (KO) [BR:mbry00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    B1812_17210
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mbry01002]
    B1812_17210
Enzymes [BR:mbry01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.103  cyclohexyl-isocyanide hydratase
     B1812_17210
Peptidases [BR:mbry01002]
 Cysteine Peptidases
  Family C56: PfpI endopeptidase family
   B1812_17210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DJ-1_PfpI GATase_3 DUF2069 GATase
Motif
Other DBs
NCBI-ProteinID: ARN82536
UniProt: A0A1W6MYC6
Position
complement(3593125..3593832)
Genome map
AA seq 235 aa AA seqDB search
MTREKDRPLQIGALLFEGIDQLDLTGPFEVLARPPDTVFRLYAKSAAPVRDVRGLRLLPD
AVLGETPRLDVLVVPGGFGQEAIMEDEETLGWIRRQAEDATHVLSVCTGALILGAAGLLK
GRRATTHWAVHHLLPYFGAVPADERVVVDGKVTTTAGVTAGLDGALRLAAALHGEEAART
IQLFMEYAPEPPFDSGSPKIASACVTESVRLLTQEITARREATARRVATRLGIEA
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgacaagagagaaagatcgacctctgcaaatcggcgcgctcctcttcgaggggatcgat
cagctcgatctcaccgggccatttgaagtcctcgcgcgtccgccggacactgtctttcgc
ctctacgccaagagcgcggcgcccgtgcgcgacgtgcgcggcttgcgccttctgcccgac
gctgtcttgggcgagacgccgcgcctcgacgttctcgtcgttcccggaggcttcggccag
gaagcgatcatggaggacgaggagacgctcggctggatcaggcggcaggcggaagacgcg
acgcatgtgctttcggtctgcaccggcgccctgatcctgggcgcagcggggctcctgaaa
ggtcgacgcgcgacgacgcattgggccgtgcatcatttgctcccctatttcggcgccgtc
cctgctgacgaacgcgtcgtcgtcgacggcaaggtgacgaccaccgccggcgtcacggcc
gggctcgacggcgccctgcggcttgccgccgcgcttcacggcgaggaggcggcgcggaca
atccagctcttcatggaatatgcgccagagccgccattcgacagcggctcgccgaagatc
gcttcagcctgcgtgaccgaaagcgtgcgactcttgacgcaggagatcacggcgcggcgc
gaagcgactgcaaggcgcgtggcgacgcggttggggatcgaggcctga

DBGET integrated database retrieval system