KEGG   Marinobacter sp. BSs20148: MRBBS_0220Help
Entry
MRBBS_0220        CDS       T02323                                 

Gene name
cobQ
Definition
(GenBank) Cobyric acid synthase
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
mbs  Marinobacter sp. BSs20148
Pathway
mbs00860  Porphyrin and chlorophyll metabolism
mbs01100  Metabolic pathways
Module
mbs_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:mbs00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MRBBS_0220 (cobQ)
Enzymes [BR:mbs01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     MRBBS_0220 (cobQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26 MobB GATase VirC1
Motif
Other DBs
NCBI-ProteinID: AFP29158
UniProt: M1FFK6
Position
226788..228296
Genome map
AA seq 502 aa AA seqDB search
MVTLMIQGTTSDAGKTTVVAALCRWLARQGVSVAPFKPQNMALNSAVTVDGGEIGRSTAL
QALACGLEPHSDMNPVLLKPQSDCGAQVILRGQVHGNMGALDYHAYKAEAMVAVMDAWRA
LSERYDVIIAEGAGSPAEINLRANDIANMGFAEAADCPVLLVGDIDRGGVFAQLVGTLEL
VSASEQNRTKGFIINRFRGDIALLEPGLDWLTERTGKPVIGVLPYLHGLIVDSEDSIGTS
GTSEAGALNVIVPVLPRISNHNDFDPLRLHPGVNLQFIGPDQAIPAADLIILPGSKSTRT
DMAFLHAQGWTQAIQKHLRYGGKVFGICGGFQMLGDRVDDPAGLEGSSGTTEGLGLLDMT
TTMVAGKQLKNVCGTLTLSNRNSGQTEAGFSGYEMHNGVSEGAALARPLGRMNGKNEGAI
SADGQVAGTYVHGIFDEPGACEALLHWAGLDHSGAAIDYQQHRLAQLDRLADQVEQHLDT
YWLRDLLGLESVTTTAGPTRQS
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggtcacactgatgattcagggcaccacgtctgacgccggcaaaaccaccgtggtggcg
gccctttgccgctggctggcacgccagggtgtgtcggtggcgccgttcaaaccgcaaaat
atggccctgaacagcgcggtgaccgtagacggcggcgaaattggccgatcgacagcattg
caagcgctggcgtgtggtcttgaaccccacagtgatatgaacccggtgttattgaagcca
caaagcgactgcggcgcccaagtgattctgcgcggccaggtgcacggcaatatgggcgcg
ctggactatcatgcctacaaagccgaggccatggtggcggttatggacgcctggcgtgcg
ctcagtgaacgctatgacgtgatcatcgctgaaggcgctggcagccctgctgaaatcaac
ctgcgcgccaacgacatcgccaatatgggctttgccgaagccgcagattgcccggtgctg
ttggtgggcgatattgaccgtggcggtgtgtttgcccagctggtaggaaccctggagttg
gtttctgcgagcgaacagaaccgcacaaaaggctttatcattaatcgctttcgcggcgat
atcgctctgctggaaccgggtctggactggctgaccgaacgcactgggaaaccggtcatt
ggcgtgctgccctatcttcacggcttgattgtggattccgaagacagcattggcaccagc
ggcacaagtgaagccggcgcgctgaatgtgattgtgccggtgctgccgcgcatcagtaac
cacaacgattttgacccgctgcgcctgcaccccggcgtaaacctgcaatttattggcccg
gaccaagccattccagcagccgacctgattattctgcccggcagcaaaagcacccgcacg
gacatggcctttcttcacgctcagggctggacgcaggccatccaaaaacacctgcgctac
ggcggcaaggtgtttggtatttgcggtggttttcagatgttgggtgatcgcgtggatgat
ccggctgggctggaaggcagcagcggcacaaccgaaggcttgggcctgctggatatgacg
accaccatggtcgccggtaaacagctgaaaaacgtttgcggaacactgacgttatcaaac
cggaattctggccagacagaggcgggtttcagcggttacgaaatgcacaacggtgtgagc
gaaggcgcggctctggcgcgcccattaggtcggatgaacggcaaaaatgaaggagctatt
agtgccgacggtcaggtagcgggtacctatgtacacggaatttttgatgagcctggggct
tgtgaagccttgctgcattgggccgggctggaccactcaggtgcagcaatagactatcag
caacatcgcctggcccagcttgaccggttggcggatcaggtggagcaacatcttgatacg
tactggttgcgcgacttgctggggctggagtcagtgacaaccacggctgggccaacgagg
cagtcatga

DBGET integrated database retrieval system