KEGG   Marinobacter sp. BSs20148: MRBBS_0553Help
Entry
MRBBS_0553        CDS       T02323                                 

Gene name
gmk
Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
mbs  Marinobacter sp. BSs20148
Pathway
mbs00230  Purine metabolism
mbs01100  Metabolic pathways
Module
mbs_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:mbs00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    MRBBS_0553 (gmk)
Enzymes [BR:mbs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     MRBBS_0553 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_35 AAA_16 cobW AAA_30 AAA_18 AAA_22 MobB
Motif
Other DBs
NCBI-ProteinID: AFP29491
UniProt: M1F6R0
Position
569773..570417
Genome map
AA seq 214 aa AA seqDB search
MSHAGEQGTLFIISAPSGAGKTSLVAQMLKHDEKLGVSVSHATRAMRSGEQDGVNYHFVS
RSEFELMIGRGDFLEHADVFGNYYGTSQVWVRQTLAAGSDVVLEIDWQGAQQVRRLQPDC
VSVFIVPPSAETLRQRLIGRGTDSVDVVERRLAEAEDECSHAVEFDYLVVNDDFDHALAD
LLAIVRGQRLRMNVQQQRHAALLAGLCNHRGLHG
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgagtcatgccggagagcagggcaccctgtttattatttctgccccctccggggccggt
aaaaccagccttgtggcgcaaatgctgaagcacgatgaaaaacttggggtgtcggtatca
cacgcgacccgcgcgatgcgcagcggtgagcaggatggcgtgaactatcattttgtcagc
cgcagcgagttcgagcttatgattggtcgcggcgatttcctggaacacgcagacgtgttc
ggaaactactacggtacgtcgcaggtgtgggtgcgccagactctggcggcgggcagtgat
gttgtgttggaaattgactggcagggagcccaacaggttcgacgtttgcagccagattgt
gtgagtgtttttattgtgccgccgtctgccgaaacactgcggcagcgcctgattggccgt
ggcaccgacagcgtggacgtggttgagcggcgtttggcagaggctgaagatgagtgtagc
cacgccgtcgagtttgattatcttgttgttaatgacgatttcgaccatgccctggcggat
ttgctagccattgttcgcggtcagcgtttgcgtatgaacgtgcaacagcagcgccatgct
gcgcttttggccgggctttgcaatcatcgcgggctgcacgggtaa

DBGET integrated database retrieval system