KEGG   Marinobacter sp. BSs20148: MRBBS_1699Help
Entry
MRBBS_1699        CDS       T02323                                 

Gene name
fadB
Definition
(GenBank) Fatty acid oxidation complex subunit alpha
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
mbs  Marinobacter sp. BSs20148
Pathway
mbs00071  Fatty acid degradation
mbs00280  Valine, leucine and isoleucine degradation
mbs00281  Geraniol degradation
mbs00310  Lysine degradation
mbs00362  Benzoate degradation
mbs00380  Tryptophan metabolism
mbs00410  beta-Alanine metabolism
mbs00640  Propanoate metabolism
mbs00650  Butanoate metabolism
mbs00903  Limonene and pinene degradation
mbs00930  Caprolactam degradation
mbs01040  Biosynthesis of unsaturated fatty acids
mbs01100  Metabolic pathways
mbs01110  Biosynthesis of secondary metabolites
mbs01120  Microbial metabolism in diverse environments
mbs01130  Biosynthesis of antibiotics
mbs01200  Carbon metabolism
mbs01212  Fatty acid metabolism
Module
mbs_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mbs00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MRBBS_1699 (fadB)
   00650 Butanoate metabolism
    MRBBS_1699 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    MRBBS_1699 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    MRBBS_1699 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MRBBS_1699 (fadB)
   00310 Lysine degradation
    MRBBS_1699 (fadB)
   00380 Tryptophan metabolism
    MRBBS_1699 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MRBBS_1699 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MRBBS_1699 (fadB)
   00281 Geraniol degradation
    MRBBS_1699 (fadB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MRBBS_1699 (fadB)
   00930 Caprolactam degradation
    MRBBS_1699 (fadB)
Enzymes [BR:mbs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     MRBBS_1699 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MRBBS_1699 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     MRBBS_1699 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     MRBBS_1699 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: AFP30636
UniProt: M1F7W3
Position
1808396..1810543
Genome map
AA seq 715 aa AA seqDB search
MIYEGKAITVKEIEGGIAQLNFDLQGESVNKFNRLTLEELRNATNILTSRTDLKGLVVTS
SKDSFIVGADITEFKDLFSGPEDELVANNLGANEIFSAIEDLPFPTVTAINGIALGGGFE
MCLATDYRVMAPKAKVGLPETKLGIFPGFGGTVRLSRLVGVDNAVEWICGATENRADVAL
KVGAVDAIVEPDKLVDAALSIIHQVNNGKLDNLARREEKKGKIKLNVMESMMAFEISKAF
VGAKAGKNYPAPVEAIKVMQKHAGMTRDKAIEVEAKGFAKMAKTEVSASLIGLFLNDQEL
KHKAKRWAKDAADVKLAAVLGAGIMGGGVAYQSALKGTPIIMKDINPEGIALGLKEAKKL
LLKRIDKGRMKPDQMADVLNSITPALNYGDFKNVDLVVEAVVENPKVKDAVLREVEGQVR
EDAILTSNTSTISIDLLAKNLKRPENFCGMHFFNPVHMMPLVEVIRGKKTSDRAIATAVA
YATAMGKTPIVVNDCPGFLVNRVLFPYFGGFIGLVRDGADFQKVDKVMEKFGWPMGPAYL
LDVVGMDTGKHAGAVMAEGFPDRMKHEGTTAIDVMFDNKRYGQKNEKGFYRYELDRKGKQ
QKVVDEESYKLLKPVVQGDKEFEDDEIIARMMIPLCLETVRCLEDGIVESPADADMGLIY
GIGFPPFRGGALRYIDQIGLDKFVELADKYADLGPLYQPTDKLREMAKNGQTFFA
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgatttacgaaggtaaagccatcacggttaaagagatcgaaggcggaatcgcccagttg
aactttgacttgcaaggcgagtctgtcaacaaattcaaccgccttaccctagaagaactc
cgtaatgcgacaaacatactgacgtcacggacggatcttaagggtcttgttgttaccagt
tccaaagacagctttattgttggcgcagacatcaccgaatttaaagatttgttttccggc
ccggaagacgaactggtggccaacaacttaggcgccaatgaaatttttagtgccattgaa
gacctgccatttcccacggttaccgccataaacggtattgcgttgggcggcggttttgaa
atgtgcctcgccaccgattaccgtgttatggcaccaaaagccaaagtgggcctaccggaa
accaagttgggtatctttccgggctttggcggcaccgtacgcctgtcacgcctggttggc
gtcgataacgcggttgagtggatctgcggtgcgaccgaaaatcgcgcagacgttgctctc
aaggtgggtgcggtcgatgcgattgttgaaccggataagctggttgacgctgcgctgagc
attattcaccaggtgaataacggcaagctcgacaatttggcgcgccgtgaagaaaagaaa
ggcaaaataaagctgaatgtcatggaaagcatgatggcattcgagatttcaaaagctttt
gtaggcgccaaggccgggaaaaactacccggcgccggttgaagcgatcaaggtgatgcag
aagcacgccggtatgactcgcgacaaagctattgaggtagaagccaagggcttcgccaaa
atggcgaaaacggaggtttctgcaagtctgatcggtctttttctgaatgaccaagaactc
aagcacaaggcgaaacgctgggccaaagacgctgccgatgtaaaactagcagcggtcctg
ggtgcaggcattatgggtggcggcgtggcgtatcagtccgcgctcaaaggcacgcctatc
atcatgaaagacatcaatcccgaaggcatcgccctgggcctgaaagaagccaagaagctt
ctgctcaagcgcattgataagggacgcatgaaaccggatcagatggcggacgtgctgaac
agcatcaccccggcgctaaattatggcgatttcaagaacgtagatttggttgttgaagca
gttgttgagaatccgaaagtaaaagatgctgttctgcgcgaagttgaaggtcaggttcgt
gaagacgccattctgacgtctaacacctcgaccatctctattgacctgttggcaaaaaat
ctcaaacgcccggaaaacttctgtggcatgcacttctttaatccagtgcacatgatgcct
ctggtcgaggttatccgcggtaagaaaaccagcgatcgtgccattgcgactgccgtggct
tatgccactgccatgggtaaaacgcccatagtggttaacgattgcccgggctttctggtc
aaccgggtgctgttcccgtacttcggtggctttatcggactggtacgtgacggcgccgac
tttcagaaagtcgacaaggtgatggaaaagtttggctggcccatgggcccggcgtatctg
ctcgatgtggttggcatggacaccggcaaacacgctggcgcagttatggctgaaggcttt
cctgatcgtatgaagcacgaaggcaccaccgccatcgacgtaatgtttgataacaagcgt
tacggccaaaaaaatgagaagggcttctaccgctacgagctggaccgcaagggcaaacag
caaaaagtagtcgacgaagaatcctataaactgctgaagccggttgttcagggtgataaa
gagtttgaagacgatgaaatcatcgcacggatgatgatcccgctgtgtctggaaaccgtt
cgttgtctggaagacggcattgtagaaagcccggctgacgccgatatgggcttgatctac
ggtattggcttccctccgttccgcggtggcgcactgcgctatatcgaccagattggcttg
gacaaatttgtggagctggctgacaaatacgcagatcttgggccgctgtatcagcctact
gacaagctgcgtgaaatggcaaaaaacggccagaccttctttgcttaa

DBGET integrated database retrieval system