KEGG   Marinobacter sp. BSs20148: MRBBS_1705Help
Entry
MRBBS_1705        CDS       T02323                                 

Gene name
sdhD
Definition
(GenBank) Succinate dehydrogenase hydrophobic membrane anchor subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
mbs  Marinobacter sp. BSs20148
Pathway
mbs00020  Citrate cycle (TCA cycle)
mbs00190  Oxidative phosphorylation
mbs00650  Butanoate metabolism
mbs01100  Metabolic pathways
mbs01110  Biosynthesis of secondary metabolites
mbs01120  Microbial metabolism in diverse environments
mbs01130  Biosynthesis of antibiotics
mbs01200  Carbon metabolism
Module
mbs_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mbs_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mbs_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mbs00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MRBBS_1705 (sdhD)
   00650 Butanoate metabolism
    MRBBS_1705 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    MRBBS_1705 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AFP30642
UniProt: M1FES7
Position
1817939..1818184
Genome map
AA seq 81 aa AA seqDB search
MFIIANPGLGYDAWAGLFSQTWMRIFTLMALFSIGAHAWVGLWTVTTDYMKSALPRFLVQ
AACGLTMFVYVVWGIQILWGF
NT seq 246 nt NT seq  +upstreamnt  +downstreamnt
gtgttcattatcgccaatcccggcttgggctacgatgcctgggcaggcctgtttagccag
acttggatgcgtatttttacgctgatggctctgttttcgattggcgcacacgcttgggtt
ggtttgtggacagtaacaactgactatatgaaatcagccctgccgcgttttctggtgcag
gccgcgtgcggtctgaccatgttcgtgtatgtggtttggggtattcagatcctgtggggg
ttttaa

DBGET integrated database retrieval system