KEGG   Marinobacter sp. BSs20148: MRBBS_1941Help
Entry
MRBBS_1941        CDS       T02323                                 

Gene name
mvaA
Definition
(GenBank) 3-hydroxy-3-methylglutaryl-coenzyme A reductase
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
mbs  Marinobacter sp. BSs20148
Pathway
mbs00900  Terpenoid backbone biosynthesis
mbs01110  Biosynthesis of secondary metabolites
mbs01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mbs00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MRBBS_1941 (mvaA)
Enzymes [BR:mbs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     MRBBS_1941 (mvaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red GHMP_kinases_N GHMP_kinases_C Flagellar_put
Motif
Other DBs
NCBI-ProteinID: AFP30878
UniProt: M1FJT5
Position
2059551..2061830
Genome map
AA seq 759 aa AA seqDB search
MARIPEFYKLSVSQRVREVRKQGLLSNQDYQALVSGNHTLSIQSADKMIENVIGVMGLPL
ALGLNFLINDKAYAIPLVVEEPSIVAALSSAAKIARAGGGFRVESSESILIGQIQVVDVP
HPQRAKAALLQRKSEILNLANSLHPNMVARGGGAKDLQVLIHPSSGQRGDMVVAHLLVDT
CDAMGANLVNTMCEGVASLVENIAEGKVFLRILSNLTDRALVKARVSIPLDALAGRGFDG
KQVRDGIILANEFASIDPYRAATHNKGIMNGIDAVALATGNDWRALETGAHAWAARGSHY
TSLTQWTRGEDGSLEGELEIPIKVGIVGGALQSNPTVAMNLRLLGVSSARELAEVMGAVG
LAQNFSAIRALATEGIQQGHMTLHARSVAAAAGATPKIFETIVDRLIESGEIKIWKAREL
IEQVVSPCVKAAKEKPQSETATEERNVSSGHGKIILLGEHAVVYGRHAIATPIPLAIQAH
VQRGGDGVQLIIPRWGVEQRLHRSAEKQHAYEESLAIIFKTLGLERESMRLEIFPNVPRA
MGLGGSAAIAVATIRALDRCFELGLDDERVNELAFECEKIAHGTPSGIDNTLSTYGQTML
FRSGESPLRKVIEIDQAVQLVVGISGIESLTAATVARVRKALKAHPELYENIFNQIDSLV
IEGVNALVGHKLETLGELMNICHGLLNAMQVSSWELEEMIQIARRHGALGAKLTGGGGGG
SIIALCPPEPGAADRIESGIREAGYQTIQVTMGGKPKNR
NT seq 2280 nt NT seq  +upstreamnt  +downstreamnt
atggcaagaattcccgagttctacaaactttcggtttctcagcgggttcgcgaagttcgc
aagcagggcctgctttcgaaccaggattaccaagcgctggttagcggcaatcacacgctc
tcgatccagtcggccgacaagatgatcgaaaacgtcatcggtgtcatggggctgccgttg
gcgctgggcctgaatttcctgatcaacgacaaggcatacgccattccattggtcgtggag
gagccttcgatcgttgcggcgctgagttctgcggccaagatcgcacgggccggcggcggc
ttccgggtcgaaagctccgagtcgattttgattggccagatccaagtcgttgacgtaccg
cacccgcagcgcgccaaggcggcactgttgcagcgtaaaagcgaaatcctgaaccttgcc
aacagcctgcacccaaacatggtggctcgcggcggcggtgccaaggacctccaagtgctg
attcacccatcatcgggccagcgcggtgacatggtcgtcgcccacctgctggtggatacg
tgcgacgcgatgggcgcgaacctggtcaacacaatgtgcgaaggcgttgcctcactggtc
gagaatatcgccgaaggcaaggtgttcctgcggattctttcaaatctgaccgatcgagcc
ctggtcaaggcccgggtctcgattccgctggacgcgctggccggccgcggtttcgatggt
aagcaggtgcgcgacggaatcatcctggccaacgaatttgcctcgatcgacccctaccgt
gcggcgacccataacaagggcatcatgaacggaatcgatgccgtggcgctggccacaggc
aacgactggcgcgcccttgagacgggcgcccatgcctgggctgcgcgcggatcccattat
acgtcgctgacccagtggacgcggggcgaagacggctcgttggaaggcgagctcgagatt
ccgatcaaggtcggtattgttgggggtgcgctgcagtccaatcccacggtggcaatgaac
ctcaggcttctgggcgtgagttcggcacgcgagctggccgaagtgatgggcgcggtgggt
cttgcgcagaacttttcggcaatccgcgcgcttgcaaccgaaggcatccagcaaggccac
atgacgctgcacgcccgaagcgttgcagccgcggccggtgcaacacccaaaatcttcgaa
accatcgtcgaccggctgatcgaatccggcgagatcaagatctggaaggcgcgagagttg
atcgagcaagttgtcagcccttgcgtgaaggccgctaaggagaaaccgcagtctgaaacc
gctaccgaggaacgcaacgtatccagcggacacggcaagatcatcctgctaggcgagcac
gcagttgtttacgggcggcacgcgatcgcgacgccgataccgttggccatacaggcgcac
gtgcagcgcggcggggacggcgtgcaactgatcattccgcgctggggcgtggagcagcga
ttgcaccgaagcgcagaaaaacagcatgcttatgaggaatccttggcgattattttcaag
acgctcggactcgaacgcgaaagcatgcgtttggaaattttccccaacgtaccgcgagcc
atgggactgggcgggtcagcggcgatcgcggtggccaccattcgcgcactagaccgttgt
tttgaactcggcctggatgacgagcgcgtcaacgagctggcgttcgagtgcgaaaaaatc
gcacacgggacgccatcgggtatcgataacacgctctcgacctatggccagaccatgctc
ttccgttccggtgaatcgccgctgcgcaaggtgatcgagatcgatcaggccgtgcagctg
gtcgtcggtattagcggtatcgagagcctgaccgcggcgacagtcgcgcgtgttcgcaag
gcactcaaagcgcaccccgaactgtacgagaatatcttcaaccagatcgattcactggtg
atcgagggagtgaatgcgctggtcgggcacaagctcgagacgctgggagagctgatgaac
atttgccatggcctgctcaacgcgatgcaggtgtcgagctgggaactggaggaaatgatc
cagattgcccgccgccacggcgctctcggggcaaagctcaccggtggcggtggcggtggt
tccatcattgcactatgtccgccggaacccggcgctgccgaccgaatagaatcgggtatc
cgtgaagccggctatcagacaattcaggttacaatgggcggtaagccgaaaaataggtga

DBGET integrated database retrieval system