KEGG   Marinobacter sp. BSs20148: MRBBS_2574Help
Entry
MRBBS_2574        CDS       T02323                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mbs  Marinobacter sp. BSs20148
Pathway
mbs00071  Fatty acid degradation
mbs00072  Synthesis and degradation of ketone bodies
mbs00280  Valine, leucine and isoleucine degradation
mbs00310  Lysine degradation
mbs00362  Benzoate degradation
mbs00380  Tryptophan metabolism
mbs00620  Pyruvate metabolism
mbs00630  Glyoxylate and dicarboxylate metabolism
mbs00640  Propanoate metabolism
mbs00650  Butanoate metabolism
mbs00900  Terpenoid backbone biosynthesis
mbs01100  Metabolic pathways
mbs01110  Biosynthesis of secondary metabolites
mbs01120  Microbial metabolism in diverse environments
mbs01130  Biosynthesis of antibiotics
mbs01200  Carbon metabolism
mbs01212  Fatty acid metabolism
mbs02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mbs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MRBBS_2574
   00630 Glyoxylate and dicarboxylate metabolism
    MRBBS_2574
   00640 Propanoate metabolism
    MRBBS_2574
   00650 Butanoate metabolism
    MRBBS_2574
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MRBBS_2574
   00072 Synthesis and degradation of ketone bodies
    MRBBS_2574
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MRBBS_2574
   00310 Lysine degradation
    MRBBS_2574
   00380 Tryptophan metabolism
    MRBBS_2574
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MRBBS_2574
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MRBBS_2574
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    MRBBS_2574
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mbs04147]
    MRBBS_2574
Enzymes [BR:mbs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MRBBS_2574
Exosome [BR:mbs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MRBBS_2574
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt DUF5417 ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AFP31510
UniProt: M1FEF7
Position
complement(2729555..2730748)
Genome map
AA seq 397 aa AA seqDB search
MTDTSNDHFVVIAGAARTPMGGMMGSLSSVPSPQLGAVAIKAAIERSGLKPADIDEVIMG
CVLPAGLGQAPARQASRGAGIPDSSGCTTVNKMCGSGMQAVMIAHDQIKAGTNNIMIAGG
MENMSQAPYILPKARGGMRMGHGQVMDSMFLDGLEDAYEGGLMGVFAQKSADDYKITREQ
MDNFAIESLNRANAAIDNGWFAPEICAVSIAGRGGDTVVDTDEQPGNARPDKIPTLKPAF
KKDGTVTAANASSISDGASALVLASAKEAKARGLHPQAKIIAHATHAQLPAEFTLAPIGA
IDKVLKKAGWGKDDVDLYEINEAFAVVSLLAINELGLDANKVNVYGGACALGHPIGSSGS
RILVTLINALKQKGLKRGVAALCIGGGEATAVAIELI
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgactgacacctctaatgatcattttgtagtaatagccggcgccgcccgcacgcccatg
ggcggcatgatgggctcgctaagcagcgtaccttcgccacagttgggcgcggttgcgata
aaagccgctatcgagcgttcgggcctgaagcctgctgacattgatgaagtcatcatgggt
tgcgtattaccggccggcttaggccaggcacccgcgcgccaggcctcccgcggcgccggc
ataccagacagctccggctgcaccaccgttaacaaaatgtgtggatcgggcatgcaggcg
gtcatgatcgcccacgatcagatcaaagccggcaccaacaacatcatgattgctggtggc
atggaaaacatgagccaggcaccttacattttgcccaaagcccgcggcggaatgcgcatg
ggccatggccaggtgatggacagcatgttcctcgacggcctggaagacgcctacgaagga
ggcctgatgggcgtgtttgcacaaaaaagcgccgatgactacaaaatcacccgtgagcaa
atggataactttgccatcgagtcccttaaccgtgctaacgcagccatcgataacggctgg
ttcgcgcccgaaatctgcgcggtcagcatcgccggtcgtggtggcgacacagtggtagat
accgacgagcagcccggcaatgcccgcccggacaagatccccacgctgaaacccgcgttc
aagaaagacggaacggtaaccgctgccaatgccagctccatcagcgacggcgcctcagca
ctggtgctggcttctgcaaaagaagccaaagctcgtggcctgcacccacaggcaaaaatc
attgcccacgccacccacgcccagttacccgctgagttcaccctggcccccatcggcgcc
atcgacaaagtcctgaaaaaagccggctggggcaaagacgacgtagacctttacgaaatc
aacgaagccttcgcggtggtctcccttttggccatcaacgaactgggcctggatgccaat
aaagtaaacgtgtacggcggcgcctgcgccctcggccaccccattggctcctccggctca
agaatcttggtcactctgattaacgcattgaagcaaaaaggcctgaaacgcggcgttgcg
gcactgtgcatcggcggtggtgaggccacggcagtggctattgagttgatctga

DBGET integrated database retrieval system