KEGG   Marinobacter sp. BSs20148: MRBBS_2594Help
Entry
MRBBS_2594        CDS       T02323                                 

Gene name
acsA
Definition
(GenBank) Acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mbs  Marinobacter sp. BSs20148
Pathway
mbs00010  Glycolysis / Gluconeogenesis
mbs00620  Pyruvate metabolism
mbs00640  Propanoate metabolism
mbs00680  Methane metabolism
mbs01100  Metabolic pathways
mbs01110  Biosynthesis of secondary metabolites
mbs01120  Microbial metabolism in diverse environments
mbs01130  Biosynthesis of antibiotics
mbs01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mbs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MRBBS_2594 (acsA)
   00620 Pyruvate metabolism
    MRBBS_2594 (acsA)
   00640 Propanoate metabolism
    MRBBS_2594 (acsA)
  Energy metabolism
   00680 Methane metabolism
    MRBBS_2594 (acsA)
Enzymes [BR:mbs01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     MRBBS_2594 (acsA)
Lipid biosynthesis proteins [BR:mbs01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   MRBBS_2594 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AFP31530
UniProt: M1FEH1
Position
complement(2750752..2752401)
Genome map
AA seq 549 aa AA seqDB search
MSLPEYVDAYNNFDLAALEAEVLDGRLDSGLNVCHEICDKWAANAEKVVLYYETEDGGDG
VLTFAELKQASARFANYLKLQGVGKGDRVAGLLPRTPELLIVMAGAWRIGAVYQPLFTAF
GSGAIEYRLERASTKLIVTNPENRLKLDDVKNCPSVLCVDSAEAGHGDADFYQALGEQSG
QFEPVLIKGTDPFLQMFTSGTVGKPKGVSVPARALLSFYVYMRDAVGLRDSDTFWNVADP
GWAYGLYYAVIGPLLMGHATHFNPNAFTPESTYDMIRKYKITNLAAAPTAYRLLKANDHV
LPEGENLGLRVASSAGEPLNPEVVNWIRRRHFCEVKDHYGQTETGMTCCNFHGLAHPVKE
GAMGFSSLGHRVVALNEKHEEVGTGEVGQVAIEVAASPLFHFDGYTWGEKDPFAQGYYLT
GDMAINNGDGSFSFSGRDDDIITTSGYRVGPADVESSLLEHPAVAESGVVAKPDEKRGAI
IKAYVVIKSDQIPADDQVLREELQNHVRRRLSTHAFPREIEFVDELPKTPSGKIQRFILR
DRAREDTSE
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgagccttccggaatacgtcgatgcgtacaacaattttgaccttgctgctctggaggcc
gaagtattggatggtcgcctggacagtgggctgaatgtttgccacgaaatttgcgataaa
tgggcagccaatgccgaaaaagttgtgctgtattacgaaacggaagacggcggtgacggc
gttcttacttttgccgagttgaaacaggcgtccgcccgttttgccaactacctgaagttg
cagggagtgggcaagggcgaccgtgttgcgggtttgttaccgcgcactccggaactgctc
attgttatggcgggcgcttggcgcattggcgctgtttatcaaccgttgtttactgcgttt
ggctctggcgctatcgaataccgcctggagcgggcgagcaccaaattgatcgtcaccaac
ccggaaaatcgtttgaagctggatgacgttaaaaactgcccgtcggtattgtgtgtcgat
tcggcggaagctggccatggtgatgctgacttttatcaggcgctgggcgagcagtccggc
caatttgaaccggtgctgattaaaggcactgaccctttcctgcaaatgtttacctcgggc
accgtgggcaagcccaaaggggtgtctgttccagcccgggcactgttgtcattctatgtt
tacatgcgcgatgcggtgggccttcgtgacagcgacacattctggaacgtggcagacccg
ggttgggcttacggtttgtactatgcggttatcgggccgctgctgatgggccacgctacc
cacttcaatcccaacgcgtttacccctgaaagcacctacgacatgatccgcaagtacaaa
attacaaatcttgcggcggcgcccacggcctatcggttgttaaaagcgaatgatcacgtg
ctgcctgaaggtgaaaatctcgggctacgggtagcgagtagcgccggcgagcccttgaat
ccggaggtggttaactggatccgtcgtcgtcatttctgtgaggtaaaagatcactacggt
cagactgaaacgggcatgacctgctgcaacttccacggcttggcgcacccggtaaaggag
ggcgccatgggtttctcatcgttagggcaccgtgttgtagcgctgaatgaaaagcatgaa
gaggtgggtaccggtgaagtcgggcaagttgccattgaggtggctgcatcgcctttgttt
catttcgatggctacacctggggtgaaaaagacccgttcgcccagggttactacctgacc
ggcgatatggccattaacaacggcgacggcagtttctcgttcagtgggcgcgacgacgac
atcattaccacctcaggttatcgagtggggccagccgatgttgaaagctcattgttggag
catccggctgtggcggagtctggtgtggtagccaagcccgatgaaaagcgtggcgccatc
atcaaggcctacgtggtgatcaaaagcgaccagattccggccgatgaccaggttctgaga
gaagaactgcagaaccatgtgcgccggcgtctgtccacccacgctttcccgcgggaaatc
gagtttgttgacgagctacccaaaacgccgagcggcaagatacagcgctttattctgcgc
gatcgcgccagggaagacaccagcgaatga

DBGET integrated database retrieval system