KEGG   Marinobacter sp. BSs20148: MRBBS_2889Help
Entry
MRBBS_2889        CDS       T02323                                 

Gene name
bdhA
Definition
(GenBank) (R,R)-butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
mbs  Marinobacter sp. BSs20148
Pathway
mbs00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:mbs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    MRBBS_2889 (bdhA)
Enzymes [BR:mbs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     MRBBS_2889 (bdhA)
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     MRBBS_2889 (bdhA)
    1.1.1.-  
     MRBBS_2889 (bdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 Glu_dehyd_C FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AFP31825
UniProt: M1FF67
Position
complement(3044393..3045451)
Genome map
AA seq 352 aa AA seqDB search
MKAARFYDKGDIRIEDIPEPTIEPGTVGIDVAWCGICGTDLHEFMEGPIFIPPCGHPHPV
SGESAPITMGHEFSGVVYAVGDGVDDIEIGQHVVVEPYIIADDVDTGPGQSYQLSKNMNF
IGLGGNGGGLSEKIAVKRRWVHPISAAIPLDQAALIEPLTVGYHAFVRSGAKAGDIALVG
GGGPIGLLLGAVLKAKGITVILTELSAKRKEKAKETGVADYVLDPSEVNVTEEVMKITKD
RGVDVSFECSSINEVLDTLVETTKPGGTVVIVSIWSHPATVNVHSVVMKELDVRGTIAYA
NNHAETIKLVEEGKVNLEPFITQRIKLDDLVAEGFERLIHNNESAVKIIVQT
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgctcgtttttatgacaaaggggatatccggattgaagatatccccgaaccg
acgatagaacccggcactgtgggcatagatgtagcctggtgcggtatctgtggtaccgat
ttgcatgaatttatggaggggcccatctttattccgccgtgcggccacccccatccggtc
tcaggggaatctgcgccaataacaatggggcatgagttttcaggtgtggtttatgctgtt
ggtgacggtgtagacgatattgaaatcggtcagcacgttgtggttgaaccttatattatt
gcggatgatgtagacacgggcccgggtcagagttaccagttgtccaaaaacatgaacttt
attggccttggtggcaacggtggcggcttatccgaaaaaatcgcagtcaagcgtcgctgg
gtgcatccgatttctgccgccattcccctcgatcaagccgctttgattgaacctcttacg
gttggctatcatgcgtttgttcgcagtggcgctaaggccggtgatattgctctggttggc
ggtggcgggcctattggcctgttattgggggctgtgttaaaggctaagggtataaccgtt
atcctcacggagttgagcgcaaagcgtaaggaaaaagcgaaagaaaccggcgttgcggat
tatgttttggatccctccgaagtcaacgtaaccgaagaggttatgaaaattaccaaagat
cggggtgtggatgtttcttttgagtgcagcagcatcaatgaagtgctggatacgctggta
gagacgacaaaaccgggcgggaccgttgttattgtatcgatttggagccacccagcgacg
gtgaatgtacacagcgttgtgatgaaagaactggacgtgcgtggaaccattgcttacgca
aacaaccatgcagaaaccattaagctggtagaggaaggcaaagttaatttggaacctttc
attacccaacgaattaaacttgatgatttggtggctgaaggtttcgagaggctgattcac
aacaatgagtcagccgtgaagatcattgttcagacataa

DBGET integrated database retrieval system