KEGG   Marinobacter sp. BSs20148: MRBBS_3555Help
Entry
MRBBS_3555        CDS       T02323                                 

Gene name
algC
Definition
(GenBank) Phosphomannomutase/phosphoglucomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
mbs  Marinobacter sp. BSs20148
Pathway
mbs00010  Glycolysis / Gluconeogenesis
mbs00030  Pentose phosphate pathway
mbs00051  Fructose and mannose metabolism
mbs00052  Galactose metabolism
mbs00230  Purine metabolism
mbs00500  Starch and sucrose metabolism
mbs00520  Amino sugar and nucleotide sugar metabolism
mbs00521  Streptomycin biosynthesis
mbs01100  Metabolic pathways
mbs01110  Biosynthesis of secondary metabolites
mbs01120  Microbial metabolism in diverse environments
mbs01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mbs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MRBBS_3555 (algC)
   00030 Pentose phosphate pathway
    MRBBS_3555 (algC)
   00051 Fructose and mannose metabolism
    MRBBS_3555 (algC)
   00052 Galactose metabolism
    MRBBS_3555 (algC)
   00500 Starch and sucrose metabolism
    MRBBS_3555 (algC)
   00520 Amino sugar and nucleotide sugar metabolism
    MRBBS_3555 (algC)
  Nucleotide metabolism
   00230 Purine metabolism
    MRBBS_3555 (algC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MRBBS_3555 (algC)
Enzymes [BR:mbs01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     MRBBS_3555 (algC)
    5.4.2.8  phosphomannomutase
     MRBBS_3555 (algC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV dCache_1 DUF2218 Orf78
Motif
Other DBs
NCBI-ProteinID: AFP32491
UniProt: M1FAS3
Position
complement(3720527..3723172)
Genome map
AA seq 881 aa AA seqDB search
MKLGKKKTPDSQALDHSEDAKPSMRAKKTSAKSDKDTGSANRMRTLGGVALSQALIVVVA
TALTLALVFFLILRPASEQQFEATAQAAADNAASRINGYLSLLHQSVQGLATQPSLVDTV
SNGGDLLQAAKQLQNSLPGVAAVYLFPRLAIPRSATNDPMLGFAGLELARKAEAGSPLFP
DAFPRDNRWFIHLAAPVKMSGDNSVAGTLLMVFDATSLQPLLVDGQNNGALALRQAVSGT
VSILLSQGSGSGEPRVVTLKNPDWSIAYTPAGQAQMPVNILLAALLLVPMLAAAIAVWVL
LNRAQRSLRRDSTLVIEWAHKAYSGERSKLPALHWDAVASLAEVLYRLSQVVEKRVSKAG
EGTRPAAVGKKRPNAEVEPLFRAKDLPDVDMLEGDEDVLGFGAVSAEPLFGAGALPEVEE
LDQAPALSADIFRAYDIRGIVDETLTEAGVELIGQAIGSEALARGVSALCVGYDGRHSSP
GLADAVARGLMASGCDVIHVGAVPTPVLYFATHQLDTGSGVMVTGSHNPSNYNGLKIMLG
GETLSGDAIKALHRRILNGNLAQGSGSQSSEDVRRAYLDTIVGDIAVAAPLKVVVDAGNG
IAGELGPMLIDELGCDVIPLYCDVDGDFPNHHPDPGKPENLRDLIAKVEQEGADLGIAFD
GDGDRIGVVTNRGRIIWPDRLLMLFARDVVSRNPGADVLYDVKCSRRLAGVISQAGGRPV
MWKTGHSLMKAKMRETGALLAGEMSGHIFFAERWYGFDDGLYAAARLLEILGIEDRHSDE
VFEDFPEDVSTPELNIEVTEASKFGIVERLSAQGEFDDGSISTIDGVRVEYGDGWGLCRA
SNTTPALVLRFEAESEEALERIKTVFREQLGQVAPELNVTF
NT seq 2646 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgggcaaaaagaagaccccggacagtcaggccctggaccattctgaggatgcc
aagccctcgatgcgggcaaaaaaaacgtctgccaaatccgataaggacacaggttcggcg
aaccgcatgcgaacactgggcggtgtcgctttgagccaggcattgattgttgttgttgcc
actgcactgactttggccctggtttttttcctgattttgcggccggccagtgaacaacag
ttcgaggcaacggcccaggcggcggctgacaacgccgcaagccgaattaacggctacctg
tcgctgttgcaccagagcgtgcagggtctggcaactcagcccagccttgtcgataccgtc
agcaatggcggcgatctgttgcaggctgcgaagcagttacaaaacagcttgcccggtgtt
gccgcggtttatttatttccacgtcttgccatcccgcgctcggccaccaacgacccgatg
ctgggctttgccggtctggagttggcgcgtaaggcggaagccggaagcccacttttcccg
gatgcttttccccgcgacaaccgctggttcattcatctggccgcgccggtaaaaatgtcg
ggcgacaattcggtagccggcaccttgttgatggtgtttgacgccaccagcctgcagcct
ctgttggtagatggccaaaataacggcgccctcgcgctgcgccaggcggtatcaggaacg
gtcagcattttgttaagtcaaggcagcggtagcggagagcctcgcgttgtgaccctgaaa
aatccggattggagcattgcatacacgcccgcagggcaagcgcaaatgccggtgaacatt
ctgttggcagcgctgctgctggttccgatgctggctgcagccatcgcggtttgggtattg
ctcaaccgcgcgcagcgctcgttacgccgggactccaccttagttattgaatgggctcac
aaggcttactctggtgagcgcagcaagttaccagctttgcactgggacgcagtcgcgtcg
ctcgccgaggtgctttaccgattgtcacaagttgtggaaaagcgcgtcagcaaggccggt
gagggcacacgtccggcagctgtgggtaaaaaacgccccaatgcagaggttgaaccacta
ttccgagcaaaagacctgcccgatgtggatatgcttgagggcgacgaagacgttctgggt
tttggtgctgtgtctgccgaaccgttgtttggtgccggagccctgcctgaggtagaagag
ctagatcaagcaccggcgctgtcagcggatatttttcgtgcttacgacatccgcggcatt
gttgatgaaaccctgactgaggccggtgttgaactgatcggtcaggcgattggttcagag
gctctggcacgaggcgtcagtgcgctttgcgtgggttacgatggtcgccattccagccct
gggctggcagatgcggttgctcgggggctgatggcaagtgggtgcgatgttatacacgtt
ggcgcggtgcccactccggtgttgtatttcgccactcaccagcttgatacgggctccggt
gtcatggttaccgggagtcataacccgtccaactacaacggcctcaagatcatgcttggt
ggtgaaaccctgtctggcgatgctattaaagccctgcatcggcgcattcttaacgggaac
ctggctcagggttccggcagccagtcgtcggaagacgtaaggcgtgcctatctggatacc
attgttggcgacatcgccgttgccgcgccgctgaaagtggtggtagacgctggtaacggc
attgccggcgagctgggccctatgctgattgacgagctgggctgtgacgttattccgctg
tattgcgatgttgatggcgacttccctaatcaccacccggacccgggcaaacctgagaat
ttgcgggacctgattgccaaggttgaacaggaaggcgctgatttgggtattgcctttgat
ggcgatggtgaccgcatcggcgtggtgactaaccgcggccgcattatctggcccgaccgc
ctgttgatgttgtttgcccgcgatgtggtgtcacgcaaccccggtgccgacgtgttgtac
gacgtgaaatgcagccggcgccttgcaggggtgatatcccaagctggcggccggccagtc
atgtggaaaaccggacattcgctgatgaaagccaaaatgcgggaaaccggcgctttgctg
gccggggagatgagcggtcacatattttttgccgaacgctggtacggttttgatgacggc
ctttacgccgctgcgcggttattggagattcttggtattgaagaccgccacagcgacgaa
gtgttcgaggatttccctgaggacgtcagcacgccggagctgaatatcgaggtcaccgaa
gcgtctaaattcggcattgttgagcgtctgagtgctcaaggtgaatttgacgacggcagt
atcagcacaattgacggagtaagggtggagtatggcgacggctggggcctgtgccgggct
tctaataccacaccggcgctggtgctgcgttttgaagcagaatctgaagaggcgttggag
cgcataaaaacggtgtttcgtgagcagcttgggcaagtggcaccagagctgaatgtcaca
ttctga

DBGET integrated database retrieval system