KEGG   Mycobacterium tuberculosis variant bovis BCG Tokyo 172: JTY_0446Help
Entry
JTY_0446          CDS       T00864                                 

Gene name
psd
Definition
(GenBank) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
mbt  Mycobacterium tuberculosis variant bovis BCG Tokyo 172
Pathway
mbt00564  Glycerophospholipid metabolism
mbt01100  Metabolic pathways
mbt01110  Biosynthesis of secondary metabolites
Module
mbt_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:mbt00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    JTY_0446 (psd)
Enzymes [BR:mbt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     JTY_0446 (psd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase DUF4131
Motif
Other DBs
NCBI-ProteinID: BAH24742
UniProt: C1AKB3
Position
complement(526535..527230)
Genome map
AA seq 231 aa AA seqDB search
MARRPRPDGPQHLLALVRSAVPPVHPAGRPFIAAGLAIAAVGHRYRWLRGTGLLAAAACA
GFFRHPQRVPPTRPAAIVAPADGVICAIDSAAPPAELSMGDTPLPRVSIFLSILDAHVQR
APVSGEVIAVQHRPGRFGSADLPEASDDNERTSVRIRMPNGAEVVAVQIAGLVARRIVCD
AHVGDKLAIGDTYGLIRFGSRLDTYLPAGAEPIVNVGQRAVAGETVLAECR
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
gtggccagacgcccccgccccgacggcccgcaacatctgctcgccctggtgcggtccgcc
gttccaccggttcatccggccgggcggccgttcattgccgccggccttgcgattgcggcc
gtcggacaccgctaccggtggttgcgcggcacgggtctgctggcggccgctgcctgcgcg
ggcttcttccggcacccgcagcgggtaccgcccaccaggccggctgccattgtcgcgccc
gccgacggcgtgatctgcgcgatcgactcagcggccccaccggccgaactcagcatgggt
gacacgccgttaccgcgagtcagcatcttcctgtcgatattggacgcccacgtgcaacgt
gccccggtgagcggggaagtgatcgccgtgcaacaccggccgggccggttcgggtcggcc
gacctaccggaggcgagcgacgacaacgagcgcaccagtgtgcggatccgcatgcccaac
ggcgccgaggtggtcgcggtgcagatcgccgggctggtggcgcgccgcattgtgtgcgac
gcacacgtcggagacaagctggccatcggtgacacctacggcctgatccggttcggctcc
cggctggatacctacctgccagcgggcgcagagccgatcgtcaacgtcggccagcgcgcg
gtcgccggcgagaccgtgctggccgaatgtcgatga

DBGET integrated database retrieval system