KEGG   Mycobacterium bovis BCG Tokyo 172: JTY_0477Help
Entry
JTY_0477          CDS       T00864                                 

Gene name
icl
Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
mbt  Mycobacterium bovis BCG Tokyo 172
Pathway
mbt00630  Glyoxylate and dicarboxylate metabolism
mbt01100  Metabolic pathways
mbt01110  Biosynthesis of secondary metabolites
mbt01120  Microbial metabolism in diverse environments
mbt01200  Carbon metabolism
Module
mbt_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mbt00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    JTY_0477 (icl)
Enzymes [BR:mbt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     JTY_0477 (icl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase DUF3338
Motif
Other DBs
NCBI-ProteinID: BAH24773
Position
558675..559961
Genome map
AA seq 428 aa AA seqDB search
MSVVGTPKSAEQIQQEWDTNPRWKDVTRTYSAEDVVALQGSVVEEHTLARRGAEVLWEQL
HDLEWVNALGALTGNMAVQQVRAGLKAIYLSGWQVAGDANLSGHTYPDQSLYPANSVPQV
VRRINNALQRADQIAKIEGDTSVENWLAPIVADGEAGFGGALNVYELQKALIAAGVAGSH
WEDQLASEKKCGHLGGKVLIPTQQHIRTLTSARLAADVADVPTVVIARTDAEAATLITSD
VDERDQPFITGERTREGFYRTKNGIEPCIARAKAYAPFADLIWMETGTPDLEAARQFSEA
VKAEYPDQMLAYNCSPSFNWKKHLDDATIAKFQKELAAMGFKFQFITLAGFHALNYSMFD
LAYGYAQNQMSAYVELQEREFAAEERGYTATKHQREVGAGYFDRIATTVDPNSSTTALTG
STEEGQFH
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtcgtcggcaccccgaagagcgcggagcagatccagcaggaatgggacacgaac
ccgcgctggaaggacgtcacccgcacctactccgccgaggacgtcgtcgccctccagggc
agcgtggtcgaggagcacacgctggcccgccgcggtgcggaggtgctgtgggagcagctg
cacgacctcgagtgggtcaacgcgctgggcgcgctgaccggcaacatggccgtccagcag
gtgcgcgccggcctgaaggccatctacctgtcgggctggcaggtcgccggcgatgccaac
ctgtccgggcacacctaccccgaccagagcctgtatcccgccaactcggtgccgcaggtg
gtccgccggatcaacaacgcactgcagcgcgccgaccagatcgccaagatcgagggcgat
acttcggtggagaactggctggcgccgattgtcgccgacggcgaggccggctttggcggc
gcgctcaacgtctacgagctgcagaaagccctgatcgccgcgggcgttgcgggttcgcac
tgggaggaccagttggcctctgagaagaagtgcggccacctgggcggcaaggtgttgatc
ccgacccagcagcacatccgcactttgacgtctgctcggctcgcggccgatgtggctgat
gttcccacggtggtgatcgcccgtaccgacgccgaggcggccacgctgatcacctccgac
gtcgacgagcgcgaccagccgttcatcaccggcgagcgcacccgggaaggcttctaccgc
accaagaacggcatcgagccttgcatcgctcgggcgaaggcctacgccccgttcgccgac
ttgatctggatggagaccggtaccccggacctcgaggccgcccggcagttctccgaggcg
gtcaaggcggagtacccggaccagatgctggcctacaactgctcgccatcgttcaactgg
aaaaagcacctcgacgacgccaccatcgccaagttccagaaggagctggcagccatgggc
ttcaagttccagttcatcacgctggccggcttccatgcgctgaactactcgatgttcgat
ctggcctacggctacgcccagaaccagatgagcgcgtatgtcgaactgcaggaacgcgag
ttcgccgccgaagaacggggctacaccgcgaccaagcaccagcgcgaggtcggtgccggc
tacttcgaccggattgccaccaccgtggacccgaattcgtcgaccaccgcgttgaccggt
tccaccgaagagggccagttccactag

DBGET integrated database retrieval system