KEGG   Mycobacterium bovis BCG Tokyo 172: JTY_0881Help
Entry
JTY_0881          CDS       T00864                                 

Gene name
fadA
Definition
(GenBank) acyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mbt  Mycobacterium bovis BCG Tokyo 172
Pathway
mbt00071  Fatty acid degradation
mbt00072  Synthesis and degradation of ketone bodies
mbt00280  Valine, leucine and isoleucine degradation
mbt00310  Lysine degradation
mbt00362  Benzoate degradation
mbt00380  Tryptophan metabolism
mbt00620  Pyruvate metabolism
mbt00630  Glyoxylate and dicarboxylate metabolism
mbt00640  Propanoate metabolism
mbt00650  Butanoate metabolism
mbt00900  Terpenoid backbone biosynthesis
mbt01100  Metabolic pathways
mbt01110  Biosynthesis of secondary metabolites
mbt01120  Microbial metabolism in diverse environments
mbt01130  Biosynthesis of antibiotics
mbt01200  Carbon metabolism
mbt01212  Fatty acid metabolism
mbt02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mbt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    JTY_0881 (fadA)
   00630 Glyoxylate and dicarboxylate metabolism
    JTY_0881 (fadA)
   00640 Propanoate metabolism
    JTY_0881 (fadA)
   00650 Butanoate metabolism
    JTY_0881 (fadA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    JTY_0881 (fadA)
   00072 Synthesis and degradation of ketone bodies
    JTY_0881 (fadA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    JTY_0881 (fadA)
   00310 Lysine degradation
    JTY_0881 (fadA)
   00380 Tryptophan metabolism
    JTY_0881 (fadA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    JTY_0881 (fadA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    JTY_0881 (fadA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    JTY_0881 (fadA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mbt04147]
    JTY_0881 (fadA)
Enzymes [BR:mbt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     JTY_0881 (fadA)
Exosome [BR:mbt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   JTY_0881 (fadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: BAH25172
Position
957299..958510
Genome map
AA seq 403 aa AA seqDB search
MSEEAFIYEAIRTPRGKQKNGSLHEVKPLSLVVGLIDELRKRHPDLDENLISDVILGCVS
PVGDQGGDIARAAVLASGMPVTSGGVQLNRFCASGLEAVNTAAQKVRSGWDDLVLAGGVE
SMSRVPMGSDGGAMGLDPATNYDVMFVPQGIGADLIATIEGFSREDVDAYALRSQQKAAE
AWSGGYFAKSVVPVRDQNGLLILDHDEHMRPDTTKEGLAKLKPAFEGLAALGGFDDVALQ
KYHWVEKINHVHTGGNSSGIVDGAALVMIGSAAAGKLQGLTPRARIVATATSGADPVIML
TGPTPATRKVLDRAGLTVDDIDLFELNEAFASVVLKFQKDLNIPDEKLNVNGGAIAMGHP
LGATGAMILGTMVDELERRNARRALITLCIGGGMGVATIIERV
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaagaagccttcatctacgaggccatccgcaccccgcgcggcaaacaaaagaac
ggatcgttgcacgaagtcaagccattgagcctggtcgtcggcctgatcgacgagctgcgc
aagcgccatcccgacctcgacgagaacctgatcagcgacgtcatcttgggctgcgtctca
ccggtgggcgaccagggcggcgacatcgcccgcgccgcagtgctggcatcgggcatgccg
gtcacctccggcggtgtgcagctcaaccggttctgcgcgtccggcctggaggccgtcaac
accgccgcgcagaaggtgcgttcgggctgggatgacctggtgctggccggcggcgtggag
tcgatgagccgggtgccgatgggctccgacggcggcgctatgggcctggacccggcgacc
aactacgacgtcatgttcgtcccgcagggcatcggcgccgacctgatcgccaccatcgag
ggcttctcccgcgaagacgtcgacgcctacgcgctacgcagccagcaaaaggccgccgag
gcgtggtcgggcggctacttcgccaagtcggtggtgccggtgcgcgaccagaacggcctg
ctgatcctcgatcatgacgaacacatgcggccggacaccaccaaggagggtctggccaag
ctgaagccggccttcgaaggcctggccgcgctgggcggtttcgacgacgtggcgctgcag
aagtaccactgggtggaaaagatcaaccacgtacacaccggcggcaacagctcggggatc
gtcgacggtgccgcgctggtgatgatcggttccgcggccgccggcaagttgcagggcctg
actccgcgggcgcgcatcgtcgccaccgccaccagcggcgccgacccggtgatcatgctc
accggccccaccccggccacccgcaaggtgctcgaccgcgccgggctgaccgtcgacgac
atcgacctgttcgagctcaacgaggcgttcgcgtcggtggtgctgaagttccagaaggac
ctcaacattcccgacgagaagctcaacgtcaacggtggcgccatcgcgatgggccacccg
ctgggtgccaccggcgcgatgatcctgggcaccatggtcgacgaactggagcgccgcaac
gcccgacgtgcactcatcacgctgtgcatcgggggcggcatgggtgtcgcgacgatcatc
gagagggtttaa

DBGET integrated database retrieval system