KEGG   Mycobacterium tuberculosis variant bovis BCG Tokyo 172: JTY_1597Help
Entry
JTY_1597          CDS       T00864                                 

Gene name
bioF1
Definition
(GenBank) 8-amino-7-oxononanoate synthase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
mbt  Mycobacterium tuberculosis variant bovis BCG Tokyo 172
Pathway
mbt00780  Biotin metabolism
mbt01100  Metabolic pathways
Module
mbt_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:mbt00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    JTY_1597 (bioF1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mbt01007]
    JTY_1597 (bioF1)
Enzymes [BR:mbt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     JTY_1597 (bioF1)
Amino acid related enzymes [BR:mbt01007]
 Aminotransferase (transaminase)
  Class II
   JTY_1597 (bioF1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5 DegT_DnrJ_EryC1 Cys_Met_Meta_PP Beta_elim_lyase Aminotran_3
Motif
Other DBs
NCBI-ProteinID: BAH25885
Position
1764098..1765258
Genome map
AA seq 386 aa AA seqDB search
MKAATQARIDDSPLAWLDAVQRQRHEAGLRRCLRPRPAVATELDLASNDYLGLSRHPAVI
DGGVQALRIWGAGATGSRLVTGDTKLHQQFEAELAEFVGAAAGLLFSSGYTANLGAVVGL
SGPGSLLVSDARSHASLVDACRLSRARVVVTPHRDVDAVDAALRSRDEQRAVVVTDSVFS
ADGSLAPVRELLEVCRRHGALLLVDEAHGLGVRGGGRGLLYELGLAGAPDVVMTTTLSKA
LGSQGGVVLGPTPVRAHLIDAARPFIFDTGLAPAAVGAARAALRVLQAEPWRPQAVLNHA
GELARMCGVAAVPDSAMVSVILGEPESAVAAAAACLDAGVKVGCFRPPTVPAGTSRLRLT
ARASLNAGELELARRVLTDVLAVARR
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgccacgcaggcacggatcgacgattcaccgttggcctggttggacgcggtg
cagcggcagcgccacgaggccggactgcggcgctgcctgcggccgcgtcccgcggtcgcc
accgagctggacttggcctccaacgactatctcggtctgtcccgacatcccgccgtcatc
gacggcggcgtccaggcgctgcggatctggggcgccggcgccaccgggtcgcgcctggtt
accggcgacaccaagctgcaccagcaattcgaggccgagctcgccgagttcgtcggcgct
gccgcgggattgctgttctcctctggctacacggccaacctgggcgccgtggtcggcctg
tccggcccgggttccctgctggtgtccgacgcccgttcgcatgcgtcgttggtggatgcc
tgtcggctgtcgcgggcgcgggttgtggtgacgccgcaccgcgacgtcgacgccgtggac
gccgcgctgcgatcgcgcgacgagcagcgcgccgtcgtcgtcaccgactcggtgttcagc
gccgacggctcgctggcgccggttcgggagttgcttgaggtctgccggcgtcatggtgcg
ctgcttctggtggacgaggcgcacggcctgggtgtgcgtggcggcggacgcgggctgctc
tacgagttaggtctagcgggtgcgcccgacgtggtgatgaccaccacgctgtccaaggcg
ctgggcagccagggtggtgtggtgctcgggccgacgccggtgcgggcccatctgatcgat
gctgcccggccgttcatcttcgacaccggtctggcgccggcggcggtgggtgccgcacgg
gccgcgctgcgcgtcttgcaggccgagccgtggcgaccgcaggcggtgctcaaccacgct
ggtgaacttgcgcggatgtgcggtgtggctgcggtgccggactcggcgatggtgtcggtg
atcctgggcgagccggagtcggcagtggccgccgcggcggcctgcctggacgccggggtc
aaggtgggctgcttccggccgccgacggtgcccgcgggtacgtcgcggctgcggctgacc
gcgcgcgcatcgctgaacgccggcgagctcgagctggcccggcgggtgctgacggatgtt
ctcgccgtggcgcgccgttga

DBGET integrated database retrieval system