KEGG   Mycobacterium tuberculosis variant bovis BCG Tokyo 172: JTY_2867Help
Entry
JTY_2867          CDS       T00864                                 

Gene name
mqo
Definition
(GenBank) malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
mbt  Mycobacterium tuberculosis variant bovis BCG Tokyo 172
Pathway
mbt00020  Citrate cycle (TCA cycle)
mbt00620  Pyruvate metabolism
mbt01100  Metabolic pathways
mbt01110  Biosynthesis of secondary metabolites
mbt01120  Microbial metabolism in diverse environments
mbt01130  Biosynthesis of antibiotics
mbt01200  Carbon metabolism
Module
mbt_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mbt_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mbt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    JTY_2867 (mqo)
   00620 Pyruvate metabolism
    JTY_2867 (mqo)
Enzymes [BR:mbt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     JTY_2867 (mqo)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: BAH27145
UniProt: C1AFW6
Position
complement(3107393..3108874)
Genome map
AA seq 493 aa AA seqDB search
MSDLARTDVVLIGAGIMSATLGVLLRRLEPNWSITLIERLDAVAAESSGPWNNAGTGHSA
LCEMNYTPEMPDGSIDITKAVRVNEQFQVTRQFWAYAAENGILTDVRSFLNPVPHVSFVH
GSRGVEYLRRRQKALAGNPLFAGTEFIESPDEFARRLPFMAAKRAFSEPVALNWAADGTD
VDFGALAKQLIGYCVQNGTTALFGHEVRNLSRQSDGSWTVTMCNRRTGEKRKLNTKFVFV
GAGGDTLPVLQKSGIKEVKGFAGFPIGGRFLRAGNPALTASHRAKVYGFPAPGAPPLGAL
HLDLRFVNGKSWLVFGPYAGWSPKFLKHGQISDLPRSIRPDNLLSVLGVGLTERRLLNYL
ISQLRLSEPERVSALREFAPSAIDSDWELTIAGQRVQVIRRDERNGGVLEFGTTVIGDAD
GSIAGLLGGSPGASTAVAIMLDVLQKCFANRYQSWLPTLKEMVPSLGVQLSNEPALFDEV
WSWSTKALKLGAA
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
gtgtcagacctagccagaaccgacgtcgtgctgatcggtgcgggcatcatgagcgccacg
ctgggggtgctgctgcgtcggctcgaaccgaactggtcaatcaccctgatcgaacggctg
gacgcggtagccgccgaaagcagcggtccctggaacaacgccggcaccgggcactccgcg
ctgtgcgagatgaactacaccccagaaatgccggacggctcgatcgacatcaccaaagcg
gtgcgtgtcaacgagcaattccaggtcacccgccagttctgggcatacgcggccgaaaac
ggcatcctcaccgacgtgcgcagcttcctcaaccctgtgccgcacgtgagtttcgtccat
ggatcgcggggcgtcgagtatctacggcgccgccaaaaggcgttggccggcaacccgctg
ttcgccggcaccgagttcatcgagagtcccgacgaattcgcccgccggctgccgttcatg
gccgctaaacgggccttctccgagccggtggcgctcaactgggccgccgacggcaccgac
gtcgacttcggtgccctcgccaaacaactcatcggctattgcgtgcaaaatggcactacc
gcgttgttcgggcacgaggttcgcaacctctcgcggcaatccgacggcagctggacggtc
accatgtgcaaccgccggaccggcgaaaagcgcaagttgaacaccaagttcgtctttgtc
ggggccgggggtgacaccttgccggtgctgcagaaatccgggatcaaagaggtcaaaggc
ttcgccggcttcccgattggcggtcggttcctgcgcgccgggaacccggcgctcaccgcc
tcgcatcgggcaaaggtatatggcttcccggcgccgggcgccccgccgttgggcgccttg
catctggatctgcggtttgtcaacggcaagtcgtggctggtgttcgggccatacgccggc
tggtcgccgaagttcttgaaacacgggcagatcagcgacctgccccggtcgatcaggccg
gacaatctgttgtccgtgctcggcgtgggcctcaccgagcggagactgctgaactacttg
atcagccagctgcgtctctctgaacccgagcgggtcagtgcgctgcgcgaattcgcccct
agcgcaatcgattcggactgggagttgacgatagccggtcagcgggtacaggtgatccgg
cgagatgaacgcaacggcggggtgctcgagttcggcacgacggtcatcggcgatgctgac
ggtagtattgccggactactgggcggctccccaggggcttcgaccgcggtggcgatcatg
ctggacgtgctgcagaaatgctttgccaaccgctatcaatcctggctgcccacgctcaaa
gaaatggtgccgtcgctgggggtgcagctgtcgaatgaacccgcgctgttcgacgaggtg
tggtcatggagcaccaaggcgctgaagttaggtgccgcatga

DBGET integrated database retrieval system