KEGG   Mycobacterium bovis BCG Tokyo 172: JTY_3383Help
Entry
JTY_3383          CDS       T00864                                 

Gene name
sdhD_3
Definition
(GenBank) putative succinate dehydrogenase
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
mbt  Mycobacterium bovis BCG Tokyo 172
Pathway
mbt00020  Citrate cycle (TCA cycle)
mbt00190  Oxidative phosphorylation
mbt00650  Butanoate metabolism
mbt01100  Metabolic pathways
mbt01110  Biosynthesis of secondary metabolites
mbt01120  Microbial metabolism in diverse environments
mbt01130  Biosynthesis of antibiotics
mbt01200  Carbon metabolism
Module
mbt_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mbt_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mbt_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mbt00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    JTY_3383 (sdhD_3)
   00650 Butanoate metabolism
    JTY_3383 (sdhD_3)
  Energy metabolism
   00190 Oxidative phosphorylation
    JTY_3383 (sdhD_3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt
Motif
Other DBs
NCBI-ProteinID: BAH27659
Position
3690904..3691338
Genome map
AA seq 144 aa AA seqDB search
MSAPVRQRSHDRPASLDNPRSPRRRAGMPNFEKFAWLFMRFSGVVLVFLAIGHLFIMLMW
DNGVYRLDFNFVAQRWASPFWQTWDLLLLWLAQLHGGNGLRTIIDDYSRKDTTRFWLNSL
LVLSMLFTLMLGTYVIVTFDPNIS
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccccggtcagacagcgcagccatgaccgtccagccagcctggacaacccacga
tcaccacggcggcgtgccggcatgcccaacttcgagaaattcgcctggctgttcatgcgg
ttttccggtgttgtgttggtgttcctggcgatcgggcacctgttcatcatgctgatgtgg
gacaacggcgtgtatcgcctggacttcaacttcgttgcccaacgctgggcgtcgccgttc
tggcagacctgggatctgctgttgttgtggctggcgcagctgcacggcggcaacggtctg
cgcaccatcattgacgactacagccgcaaagacaccacccgattctggctgaactcgttg
ctggtgttgtccatgctgttcaccctgatgctgggaacctacgtgatagtgacattcgac
ccgaacatctcctga

DBGET integrated database retrieval system