KEGG   Methanococcoides burtonii: Mbur_1308Help
Entry
Mbur_1308         CDS       T00341                                 

Definition
(GenBank) oxidoreductase with FAD binding domain
  KO
K17830  digeranylgeranylglycerophospholipid reductase [EC:1.3.1.101 1.3.7.11]
Organism
mbu  Methanococcoides burtonii
Pathway
mbu00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:mbu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Mbur_1308
Enzymes [BR:mbu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.101  2,3-bis-O-geranylgeranyl-sn-glycerol 1-phosphate reductase [NAD(P)H]
     Mbur_1308
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.11  2,3-bis-O-geranylgeranyl-sn-glycero-phospholipid reductase
     Mbur_1308
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_3 FAD_binding_2 FAD_oxidored HI0933_like NAD_binding_8 Pyr_redox_2 GIDA Lycopene_cycl Thi4 DAO Trp_halogenase Pyr_redox_3 AlaDh_PNT_C 3HCDH_N Pyr_redox
Motif
Other DBs
NCBI-ProteinID: ABE52226
UniProt: Q12WF0
Position
1392599..1393819
Genome map
AA seq 406 aa AA seqDB search
MKDHYDVIVVGAGPGGSIAAKTAAKEGLDVLMIEKRQEIGDPIRCAEGVGKFHLKQHIEP
DPRWICADVKGSYIISPDGTRIEMAEEMSGGEVGYVLERKIFDRALANESALAGAEVRVK
TRATDLIIENDTVCGIKLMHLGKEYEVRSKIVIGADGVESKVGRWAGIETSVKPSDIETC
AQYLVSNANIDQEFCYFYLGNEIAPAGYVWMFPKGGNKANVGIGILGSRAGKDKPIELLN
DFIEKNMPDAKIIEMVIGGVPVCGTIERTIANGLMLVGDAARQSDPITGGGIINAMDAGK
IAGEIAAKAIRKGDCSIDTLQEYEDLWRATIGKEINNSLIVKDTFINFTDEDLNSLAYSL
RDINFTSMSLINLLKALFKANKKLLWDLRGIFKDVIKGEIDFKYKA
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaccactacgatgtcattgttgttggtgcaggcccaggaggatcaattgctgca
aaaacagcggcaaaggaaggactggacgtattgatgatagaaaagagacaggagattggc
gaccctatcagatgcgctgaaggcgtaggtaaatttcatttaaaacaacatattgaacca
gatccacgatggatatgtgcagatgtaaaagggtcatacatcatttcaccggacggaaca
aggatcgaaatggcagaggagatgtccggcggggaagttggttatgtactcgagcggaag
atatttgacagggcacttgctaacgaaagcgcattggccggtgctgaagtacgggtcaag
acaagagcaactgacctgataattgaaaatgatactgtctgcggaatcaagctcatgcat
ttaggaaaagagtatgaggtgcgctcaaagatagttattggtgcagatggggtagaatca
aaggtaggacgttgggcaggtattgaaacatcagtgaaaccttctgacatagaaacctgt
gcacagtacctcgtaagtaatgctaatattgaccaggaattctgctatttctacctaggg
aatgaaatagcacctgctggttatgtatggatgttcccaaaaggtgggaacaaggcaaat
gtaggaatagggatactgggtagcagagctggtaaagataagcccatagaactccttaat
gactttatagaaaagaacatgcctgatgccaagatcatcgaaatggtgataggcggtgtg
ccggtttgtggaactattgaaagaacgatagctaatggacttatgcttgtaggagatgct
gcacgccagtcagacccaataacaggcggcggaattatcaatgccatggacgcaggaaag
atagcaggagaaattgctgccaaagctatccgaaaaggcgattgttccatagatacgctt
caggaatatgaagacctctggagagcaacaattggaaaagagatcaacaatagccttatt
gtcaaagatacgttcattaattttactgacgaagacctcaattcccttgcatattccctc
agagatataaactttacaagcatgagccttattaatctgttaaaagcattattcaaagca
aacaaaaagcttctctgggacctcagaggaatatttaaagatgtcatcaagggtgagatc
gattttaagtacaaagcataa

DBGET integrated database retrieval system