KEGG   Methanococcoides burtonii: Mbur_1516Help
Entry
Mbur_1516         CDS       T00341                                 

Gene name
hdrC
Definition
(GenBank) CoB--CoM heterodisulfide reductase iron-sulfur subunit C
  KO
K03390  heterodisulfide reductase subunit C2 [EC:1.8.7.3 1.8.98.4 1.8.98.5 1.8.98.6]
Organism
mbu  Methanococcoides burtonii
Pathway
mbu00680  Methane metabolism
mbu01100  Metabolic pathways
mbu01120  Microbial metabolism in diverse environments
mbu01200  Carbon metabolism
Module
mbu_M00356  Methanogenesis, methanol => methane
mbu_M00357  Methanogenesis, acetate => methane
mbu_M00563  Methanogenesis, methylamine/dimethylamine/trimethylamine => methane
mbu_M00567  Methanogenesis, CO2 => methane
mbu_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mbu00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    Mbur_1516 (hdrC)
Enzymes [BR:mbu01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.7  With an iron-sulfur protein as acceptor
    1.8.7.3  ferredoxin:CoB-CoM heterodisulfide reductase
     Mbur_1516 (hdrC)
   1.8.98  With other, known, physiological acceptors
    1.8.98.4  coenzyme F420:CoB-CoM heterodisulfide,ferredoxin reductase
     Mbur_1516 (hdrC)
    1.8.98.5  H2:CoB-CoM heterodisulfide,ferredoxin reductase
     Mbur_1516 (hdrC)
    1.8.98.6  formate:CoB-CoM heterodisulfide,ferredoxin reductase
     Mbur_1516 (hdrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_8 Fer4_10 Fer4_17 Fer4_9 Fer4_7 Fer4_21 Fer4 Fer4_2 Fer4_4 Fer4_18 SCIFF Fer4_3 Fer4_20
Motif
Other DBs
NCBI-ProteinID: ABE52423
UniProt: Q12VV3
Position
1593881..1594375
Genome map
AA seq 164 aa AA seqDB search
MSATNGSTFLSRLDKTGTDILKCMHCGVCTGSCPSGRHTSLNVRNLLRKARKGESVLSDE
TLWTCTTCYNCQERCPRGIDIVDAIFEIRAIAVHEGIILPEHRTVGKLLIEHGHAVPINA
ENRTKRISLGMDEMPPTVHSYPDALNEVKKLLADCKFDELMLNE
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctacaaatggatcaacttttctatccaggctggataaaacgggaactgacatt
ctcaaatgcatgcattgtggcgtttgtaccggcagttgtccgtctggaaggcatacgagc
ctgaatgtaaggaatttgctcaggaaagctcgcaaaggtgaatctgtgctttctgatgag
acactttggacatgtacaacatgttataattgccaggaacgttgcccgaggggaattgat
attgttgatgctatttttgagatacgtgcaatagcagtacatgaagggatcatcctcccg
gaacatcgcaccgtgggtaaactgttaatcgaacatgggcatgcagtccccataaatgct
gagaacagaacaaagagaatatcacttgggatggatgaaatgccacccacagtacatagt
tatccggatgctttgaatgaagttaagaagttgcttgctgactgtaaattcgatgagttg
atgctaaatgagtga

DBGET integrated database retrieval system