KEGG   Methanococcoides burtonii: Mbur_1995Help
Entry
Mbur_1995         CDS       T00341                                 

Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mbu  Methanococcoides burtonii
Pathway
mbu00010  Glycolysis / Gluconeogenesis
mbu00051  Fructose and mannose metabolism
mbu00562  Inositol phosphate metabolism
mbu01100  Metabolic pathways
mbu01110  Biosynthesis of secondary metabolites
mbu01120  Microbial metabolism in diverse environments
mbu01130  Biosynthesis of antibiotics
mbu01200  Carbon metabolism
mbu01230  Biosynthesis of amino acids
Module
mbu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mbu_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mbu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mbur_1995
   00051 Fructose and mannose metabolism
    Mbur_1995
   00562 Inositol phosphate metabolism
    Mbur_1995
Enzymes [BR:mbu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Mbur_1995
Exosome [BR:mbu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Mbur_1995
  Exosomal proteins of bladder cancer cells
   Mbur_1995
  Exosomal proteins of melanoma cells
   Mbur_1995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM ThiG NMO
Motif
Other DBs
NCBI-ProteinID: ABE52874
UniProt: Q12UK2
Position
2097055..2097720
Genome map
AA seq 221 aa AA seqDB search
MKPLIVLNLKTYLEGTGEGAVRIARACKEVGEASGIEIAIAPQFCDIYRVASQVDVPVYS
QHLDGVGAGSFTGHAFAKCIKDAGAVGTLINHSECRLKLADIEASVTAAKGEGLRTIICT
NNIATTAAAAALGPDYVAVEPPELIGSGIPVSKADPEVVTGSVAAVERIDPAVKVLCGAG
ISKGEDLKAAIELGSVGVLLASGIVKAKDPKAALEDLVSLI
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
ttgaaacctttgatagtattgaacctaaagacatatctcgaaggtaccggggaaggtgct
gtaaggatagctcgtgcctgtaaagaggtcggtgaagcaagcgggatcgagatcgctatc
gcacctcagttctgtgatatctacagggtcgcatctcaggtagatgttcctgtatattcc
cagcatctcgatggtgtcggagcaggcagttttaccggacatgcttttgcaaagtgtata
aaggatgccggagctgtgggtacgcttatcaatcactcggagtgcagattgaaacttgct
gacatcgaagcttctgtgacggcagcaaaaggtgaaggtcttcgcactataatctgtact
aataatattgcaacaacagcagcagcagcggcattaggtcctgactatgttgcagttgag
cctcctgaacttataggctctggaattccagtctcaaaggcagatccagaggttgtaaca
ggttctgtggcagcagtggaaaggatcgatccggcagtgaaagtgctttgtggtgctggt
atctccaaaggggaggaccttaaagctgcaatagaacttggttcagtcggtgtgcttctt
gcatcaggcattgtaaaggccaaagatccaaaagctgcgcttgaagatcttgtcagtctt
atttaa

DBGET integrated database retrieval system