KEGG   Methanococcoides burtonii: Mbur_2361Help
Entry
Mbur_2361         CDS       T00341                                 

Gene name
cbiP
Definition
(GenBank) Cobyric acid synthase
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
mbu  Methanococcoides burtonii
Pathway
mbu00860  Porphyrin and chlorophyll metabolism
mbu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mbu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mbur_2361 (cbiP)
Enzymes [BR:mbu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     Mbur_2361 (cbiP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26 GATase SNO
Motif
Other DBs
NCBI-ProteinID: ABE53214
UniProt: Q12TL2
Position
2493258..2494745
Genome map
AA seq 495 aa AA seqDB search
MTANNANKKHLLVLGTASHVGKSAIVTALCRIFSADHKVAPFKAQNMSLNSWITVDGKEI
GIAQAIQAKAAGVEPTADMNPVLLKPKGDRVSQVILLGEPYADKSAGAYYDSIEETHDVL
KGALKRLEAEYDLIVMEGAGGAAEINLYDRDIVNIGTARITDAPIILVGDIERGGVFASL
YGTIQLLPEDVRKNVRGLIINKFRGDPAILESGLTELEELTGIPVLGVMPYFKLRIPSED
SVSIGDKSADDGEHYDVDIAVIRLTRISNFTDFEPLEHMAKVRYVDLSDDLGNPDAIIIP
GTKNTTSDLNDLVESGMADKIKSFYGMVPILGICGGYQMLGKSIVDSGIEGGESARLDGL
GLLDIETVFDAYEKRTVQVTKTVKESGPIFDSIKGEDVKGYEIHMGISSSKRPVFGDDGC
ADDSGLVIGTYLHGLFDNVNIRRALISYLLEKKGLEFKEEEIPDKDPYDELADVARENLD
MNKIYGMIGLEPEKV
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgactgcaaataacgctaataaaaaacatctgttagtattgggtacagcctcacatgtt
ggtaaaagtgcaatagtgacggctctgtgtcgcatattctctgctgatcacaaagtcgca
ccttttaaggcacagaacatgagcctgaactcatggattacggtggatggtaaagagatc
ggtattgcacaggcgatacaggcaaaagctgcgggagttgaacctacggcagatatgaat
cctgttcttcttaaaccaaaaggcgatcgtgtctcacaagttatacttcttggcgaaccc
tatgctgataaaagtgcgggtgcatactatgattccattgaagagacccacgatgtatta
aaaggtgctcttaaaagacttgaggctgaatatgatcttattgtgatggagggtgcaggt
ggtgctgccgagattaatctgtatgaccgtgatattgtcaatatagggacagcaaggata
accgatgctcctatcatcctcgttggtgatattgaacgaggtggtgtttttgcaagtttg
tatgggacgatccagttattgccagaggatgttcgcaagaatgtgcgtggtctgatcata
aacaagttcaggggcgatcccgctatattggagtcaggattgactgaactcgaagagctc
acagggatccctgtccttggtgtaatgccttatttcaaacttcgtataccttctgaagat
tcggtatccatcggtgacaaatctgcagatgacggtgaacactatgatgttgacatcgca
gtaataaggttgacaaggatatcgaatttcacggactttgaaccccttgagcatatggca
aaggtaaggtatgtcgacctttctgatgaccttggaaaccccgatgcgatcatcatcccg
ggtacaaagaacacgaccagtgatctgaatgacctcgtagagagtgggatggctgacaag
atcaagtccttttacggcatggttcccatacttggtatctgcggtggttatcagatgtta
ggcaaatccattgttgattccggtatcgaaggtggtgaatctgctcgcttggatggactt
ggacttctggatatagagaccgttttcgatgcatacgaaaagcgtacggttcaggtaacc
aagaccgttaaggaaagtggtcctatctttgacagtatcaaaggtgaggatgtgaagggg
tatgagatacatatgggcatttcttcatcaaaaagaccggtgtttggcgatgatggctgt
gcagacgatagtggtcttgttataggcacctatctgcatggtctctttgataatgtcaac
ataaggcgtgcacttatcagttatcttctcgaaaagaagggtctcgagttcaaggaagaa
gagattcctgataaggatccctatgatgaacttgcagatgttgctcgtgaaaatcttgac
atgaataaaatatatggtatgatcggattggagcctgaaaaggtctga

DBGET integrated database retrieval system