KEGG   Methanococcoides burtonii: Mbur_2421Help
Entry
Mbur_2421         CDS       T00341                                 

Gene name
mcrB
Definition
(GenBank) methyl-coenzyme M reductase, subunit beta
  KO
K00401  methyl-coenzyme M reductase beta subunit [EC:2.8.4.1]
Organism
mbu  Methanococcoides burtonii
Pathway
mbu00680  Methane metabolism
mbu01100  Metabolic pathways
mbu01120  Microbial metabolism in diverse environments
mbu01200  Carbon metabolism
Module
mbu_M00356  Methanogenesis, methanol => methane
mbu_M00357  Methanogenesis, acetate => methane
mbu_M00563  Methanogenesis, methylamine/dimethylamine/trimethylamine => methane
mbu_M00567  Methanogenesis, CO2 => methane
mbu_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mbu00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    Mbur_2421 (mcrB)
Enzymes [BR:mbu01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.4  Transferring alkylthio groups
    2.8.4.1  coenzyme-B sulfoethylthiotransferase
     Mbur_2421 (mcrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MCR_beta MCR_beta_N
Motif
Other DBs
NCBI-ProteinID: ABE53272
UniProt: Q12TF4
Position
complement(2547584..2548888)
Genome map
AA seq 434 aa AA seqDB search
MSDKVDIYDDRGTLLESDVDILNLAPTTNTAIGKIIKDTKRTVAINLAGIEKGLATGKYG
GKGRQILGRSLEYDIVGNADAIAESVANLVKVSNDDDTVVKVIGGGKQLLVQVPSARTDA
GADFVSGSTVSGAAVVETIINTFNTDMFDAPLVKGAVWGSYPQTMDMSGGNVASILSIPQ
QNEGLGFSLRNIMTNHVAAITGRKAMNAAALSSIYEQAGMYEMGNAVGSFERHQLLGFAY
QGLNANNVVYDIVKENGKTGTIGTVIDTVIEKAIDLGVIEVDHTAPSGYKFYKANDVSMW
NACAAAGQLAATLVNCGAGRAAQNVSSTIVYFNDILEKQTGLPGCDMGRAQGTGVGFSFF
SHSIYGGGGPGIFNGNHVVTRHSRGFAIPCVSAACAIDAGTQMITIEKTSALVGNVFGSI
EEFREPIKAVAGAL
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
gtgtctgacaaagtagacatatatgacgacagaggtacactgttggaaagcgatgtagat
atactcaacctcgccccaacaacaaatacagcaataggaaagatcatcaaagacacaaag
agaactgttgctatcaatcttgcaggtatagagaaaggtctcgcaaccggcaagtatggt
ggtaaaggacgtcagattctcggacgcagtcttgaatatgatatcgtagggaacgcagat
gctatcgcagagtctgttgcaaaccttgtaaaggtaagcaatgatgacgacacagtagta
aaagtgatcggcggcggaaaacaacttcttgtgcaggtcccaagcgcaagaacagacgct
ggtgctgacttcgtttcaggaagcacagtaagtggcgcagctgttgtagagaccatcatt
aatacgttcaacaccgacatgttcgatgcaccactagtaaagggcgctgtctggggtagc
tacccacagaccatggacatgagtggcggtaacgttgcatcaattctcagcataccacag
cagaatgaaggtctcggtttctccttgaggaacatcatgaccaaccacgtcgctgctatc
acaggcagaaaggcaatgaacgctgctgcactctcttcgatctacgagcaagcaggtatg
tacgagatgggtaatgcggtaggttcattcgagagacaccagttacttggatttgcatat
cagggtcttaacgctaacaacgtagtctatgatatcgtcaaagagaacggtaagaccggt
acaatcggcacagttatcgatacagttatcgagaaagcaatcgatctcggcgtcatcgaa
gttgaccacacagcaccatccggatacaaattctataaagcaaatgacgtatccatgtgg
aacgcatgcgcagcagctggtcagcttgcagctacactcgtaaactgtggagcaggcaga
gcagctcagaacgtatcatcaactatcgtgtacttcaacgatatactcgagaagcaaaca
ggtcttcctggctgtgacatgggtagagcacagggtactggagtcggattctctttcttc
agccactcaatctacggtggtggaggtccaggtatcttcaacggtaaccacgttgtaaca
agacactccagaggattcgcaattccttgtgtatccgctgcatgtgcaattgacgcaggt
actcagatgataactatcgaaaagacatctgcacttgtcggaaatgtgttcggttcgatc
gaagaattcagagagccaatcaaagcagttgcaggggcactctaa

DBGET integrated database retrieval system