KEGG   Methylomicrobium buryatense: EQU24_03225Help
Entry
EQU24_03225       CDS       T05995                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
mbur  Methylomicrobium buryatense
Brite
KEGG Orthology (KO) [BR:mbur00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    EQU24_03225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 DUF294_C Sec20
Motif
Other DBs
NCBI-ProteinID: QCW81373
UniProt: A0A4P9ULU8
Position
complement(685186..686763)
Genome map
AA seq 525 aa AA seqDB search
MDLNDLNQINKASSSARKDLIRLSLGLAFILLVVLYLINKEHVQGHLMLVIAAVFGSYMA
LNIGANDVANNVGPAVGSKALTMTGAIAIAAIFEASGTLIAGGDVVTTIKDGIINPQMIR
DSDTFIWLMMAALLAAAIWLNVATSLNAPVSTTHSIVGGVLGAGVAAGGLEIANWPVMGK
IAASWVISPVLGGLFSAGFLYVVKRKITYQPNMLIAAQKVVPVLIALMTWAFSTYLIMKG
LKQIIKIDFPIAASISLIFAIVIFLIVKPRIVKASIHLEPSKSSVNNLFTLPLIFSAALL
SFAHGANDVANAVGPLAAINDAIFQQGVSDKAHIPLWIMILGAAGLSIGLALYGPKLIRT
VGSEITELDKMRAFCIAMSAAITVIFASQMGLPISSTHTAVGAVFGVGFLREYLKHSNAK
RMEEIRAHHEHNDPEKIAEFLNAFKKASIAKKGQMLKELKRQAKLQIDTSLLTKKERKSL
KKVYRQELVKRSHLYKIAAAWLVTVPLSGMLGGLLFFTIRGIMLP
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atggatcttaacgacctcaatcaaatcaacaaagccagttcgtcggctcgcaaagacttg
atccgccttagcctaggcctcgcttttatcctcttggttgttctctatttgattaataaa
gaacacgtccaaggacatttaatgctggttatcgccgctgttttcggcagttatatggca
ttgaacatcggcgctaacgatgtcgccaataatgtcggcccagcagtcggctcgaaagcg
ctaacaatgaccggcgccattgccattgccgctattttcgaggcatccggcacgctaata
gccggcggagacgtggtcacgaccatcaaggacggtatcatcaatcctcaaatgattcgc
gactccgatacctttatctggttaatgatggcggcactgctggctgcggcgatttggttg
aacgtggcgacctcgctcaatgcgccggtttcgacgacccattctatagtcggaggcgtg
ctaggcgcaggagtcgccgccggcggacttgaaatcgccaattggccggtcatgggaaaa
atcgcagccagctgggtcatttcgccggttttgggcggcctgttctcggccggtttttta
tatgtggtcaagcgaaaaatcacttatcaaccgaatatgctcatagcggcgcaaaaggtc
gtcccggtattgatcgcattgatgacctgggctttttcgacctatttgatcatgaaaggt
ctgaagcaaatcattaaaatcgatttcccgatcgccgcctcgatcagcctcattttcgcc
attgttatttttcttatcgtcaaaccgcgtattgttaaagcctctattcatcttgagcca
agcaaatccagcgtgaataatttattcacgctacccttgatattttcggccgcactattg
agtttcgcgcatggcgccaacgatgtcgccaacgcggtcggccccctcgcggctatcaac
gatgccatttttcagcaaggcgtcagcgataaagcccatattccactttggatcatgata
cttggtgccgccggcttatcgataggtcttgccttatacggccctaaattgattcgcacc
gtaggcagcgaaattaccgaactcgataaaatgcgcgcattttgcatagcgatgtcggct
gccattaccgtaatattcgccagccagatggggcttcccattagctccacccatactgcg
gttggcgcggtattcggcgtcggttttttacgggaatatttaaaacacagcaacgccaaa
agaatggaagaaatccgcgctcaccacgagcataacgaccctgaaaaaatcgccgaattt
ttgaatgcctttaaaaaagcatccatcgccaaaaaagggcaaatgctcaaggagcttaaa
cgacaagccaaactacaaatcgacaccagcttactcactaaaaaagaacgtaaatcgtta
aaaaaagtctatcgtcaagaacttgtcaaacgctcccatctctataaaatcgccgcagca
tggttagttaccgttcctttatcgggaatgctcggcggcttattgttttttacgatcaga
ggaatcatgctcccttaa

DBGET integrated database retrieval system