KEGG   Methylomicrobium buryatense: EQU24_04555Help
Entry
EQU24_04555       CDS       T05995                                 

Definition
(GenBank) formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
mbur  Methylomicrobium buryatense
Pathway
mbur00670  One carbon pool by folate
mbur01100  Metabolic pathways
mbur01120  Microbial metabolism in diverse environments
mbur01200  Carbon metabolism
Module
mbur_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:mbur00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    EQU24_04555
Enzymes [BR:mbur01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     EQU24_04555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS
Motif
Other DBs
NCBI-ProteinID: QCW81599
UniProt: A0A4P9UK56
Position
complement(952181..953854)
Genome map
AA seq 557 aa AA seqDB search
MSDIAIAQQAQMRPIIDLAGEKLGIPAEHLDPYGHYKAKLSLEYVNNLTDREDGKLILVT
AISPTPAGEGKTTTTVGLGDAINRLGNSAIMCLREPSLGPCFGVKGGAAGGGYSQVVPME
DINLHFTGDFHAIGVAHNLLSALIDNHINHGNALDIDSRRIQWKRVVDMNDRALRKITVG
MGGPANGYLREDGYDIVVASEIMAILCLATSRVDLKERLGRIVIGYKSDRVTPVYASDLN
AQGAMAALLKEAIKPNLVQTLENNIAIIHGGPFANIAHGCNTVTATKTALKLADYVVTEA
GFGADLGAEKFLDIKCRMSGLKPSAVVLVATVRALKFHGGVAKEELNQENIDALQKGFTN
LERHLDNIQRHYGLPCVICINHFTFDTDAEIALLKDKCEALGAKCVVSKHWAQGGAGAEE
LAQEVLAVVDNREPGFTYVYDEELPLWDKIETIATKLYGAIGITASPKVKAEINTLQQNH
GKFPVCMAKTQMSFSTNPNERGAPSGHTVEISEVRLANGAGFIVAIAGDMMTMPGLPKVP
AAERIDITDDGVITGLF
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgtcagacatagcaatcgcccaacaagcccaaatgcgaccgatcatcgacttggccggc
gaaaaactcggcatcccggccgagcatttagatccatacggtcactataaggctaaatta
tcgctcgaatacgtcaataacttgaccgaccgcgaagacggcaaattgattctcgtcacc
gcgatcagcccgaccccggctggcgaaggcaaaaccacaactacggtaggtttaggcgat
gcgatcaaccggctcggcaattcggcgatcatgtgcctgcgcgaaccgtcgctcgggcct
tgtttcggcgtcaaaggcggcgcggccggcggcggctactcgcaagtcgtgccgatggaa
gacattaatctgcatttcaccggcgactttcatgcaatcggcgtcgcacacaatctcttg
tcggcattgatcgacaaccatatcaatcacggcaacgcacttgacatcgattcgcgccgg
attcaatggaaacgagtcgtcgacatgaacgaccgagcgttgcgcaaaatcactgtcggc
atgggcggcccggctaacggctatctgcgcgaggacggatacgacatcgtcgtcgcgtcc
gaaatcatggcgattttgtgcctggcgacaagccgcgtcgacttaaaagaacgcctcggc
cgaatcgtcatcggctacaagtccgaccgagtcacgccggtttatgcgagcgatctcaat
gcgcaaggggcaatggccgccttattgaaagaagccataaagccgaatctagtgcaaacg
cttgaaaacaatatcgcgatcattcacggcggcccgttcgcgaatatcgcgcacggttgc
aacaccgtcaccgcgacgaaaactgcgttaaaactggccgattatgtcgtgaccgaagcg
ggtttcggcgccgatttaggcgccgagaagtttctcgacatcaaatgccgcatgtccggc
ctgaaaccgtcggcagtcgtattggtcgcgacggtacgcgcgttgaaattccacggcggc
gtcgcgaaagaggagttgaaccaagaaaacatcgacgctctgcaaaaaggtttcaccaac
ctggagcgtcatctcgacaatatccaacgccattacggcttgccttgcgtaatctgcatc
aatcatttcaccttcgacaccgacgccgaaatcgcgctgctcaaagacaaatgcgaggcg
ctcggcgcgaaatgcgtggtctcgaaacattgggcgcaaggcggcgccggcgcggaagaa
ttagcgcaagaagtgcttgccgtcgtcgacaaccgcgagcccggtttcacttatgtctat
gacgaagagctgccgctgtgggataagatcgaaacgatagcgaccaaactttacggcgca
atcggcatcaccgcgagcccgaaagtcaaagccgaaatcaacacgctgcaacaaaaccac
ggcaaatttccggtttgcatggccaaaacgcaaatgtcgttctcgaccaacccgaacgag
cgaggcgcgccttccggacacacggtcgaaatcagcgaagtcaggcttgccaacggggct
ggcttcatcgtcgcgatcgccggcgacatgatgacgatgcccggtttgccaaaagtcccg
gccgccgaacgtatcgacatcaccgatgatggcgtgattacagggttgttttaa

DBGET integrated database retrieval system