KEGG   Methylomicrobium buryatense: EQU24_08035Help
Entry
EQU24_08035       CDS       T05995                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
mbur  Methylomicrobium buryatense
Pathway
mbur00480  Glutathione metabolism
mbur00590  Arachidonic acid metabolism
mbur01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mbur00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    EQU24_08035
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    EQU24_08035
Enzymes [BR:mbur01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     EQU24_08035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: QCW82196
UniProt: A0A4P9URB7
Position
complement(1774092..1774634)
Genome map
AA seq 180 aa AA seqDB search
MKTKFLLISLLFFITPVVWAEPCTELLNYKMTKLRSREQVDFCQAYQGKIILAVNTASNC
GYTGQFKGLEALYQKYKDQGLVILGFPSNDFNQEFAEEAKTAKVCYINYGVTFPMFQTSK
IKSPNANKFFQDLIESTGKAPEWNFYKYLISSNGKNISAFESSVTPEQLDAKIQALITTQ
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactaaatttttactgataagccttttattctttataacgccagtcgtctgggcc
gaaccatgcactgaattattgaattacaaaatgaccaaattaaggtcgcgtgagcaagtt
gatttttgtcaagcctatcaagggaagataattttggcagttaatacggccagtaattgc
ggctatacgggacaatttaaaggcttagaagcactgtatcaaaaatacaaagatcaaggt
ttggttattctgggctttccatccaatgatttcaatcaagagtttgccgaagaagcgaag
accgcaaaagtctgttacatcaattacggtgttacttttccaatgttccaaacgagtaag
atcaagagcccaaatgcaaataaattcttccaagacttgatcgaatctaccggtaaggca
cctgagtggaatttttacaaatatcttattagctcaaacggtaaaaacatttcagcattt
gaaagcagtgtcacacccgaacagctcgatgcgaaaattcaagccttaattacgactcag
taa

DBGET integrated database retrieval system